KEGG   Campylobacter jejuni RM1221: CJE1588Help
Entry
CJE1588           CDS       T00227                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CJE1588 (tpiA)
   01230 Biosynthesis of amino acids
    CJE1588 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJE1588 (tpiA)
   00051 Fructose and mannose metabolism
    CJE1588 (tpiA)
   00562 Inositol phosphate metabolism
    CJE1588 (tpiA)
Enzymes [BR:cjr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CJE1588 (tpiA)
Exosome [BR:cjr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CJE1588 (tpiA)
  Exosomal proteins of bladder cancer cells
   CJE1588 (tpiA)
  Exosomal proteins of melanoma cells
   CJE1588 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1489954..1490625)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAEILNKTMGAKCDDIIVFPPSVAFLENENNFIQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagagcaagctttaaaatttatgct
gaaattttaaataaaaccatgggagcaaaatgtgatgatattatcgttttcccacctagt
gtagcatttttagaaaatgaaaataacttcatacaaggagcgcaaaatttttatccttgt
gttaatggtgcttttacaggcgagcttggaaaagagcatttggacgaatttgggatcaaa
tgtgttttaatcgggcattctgaaagaagagctttaggagatgaagaatttattaaggct
aaatttgattttgctaaagagcatggttataaaattgttttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agcgcacaaagtacagatatcgctaaagtgcttgaatttttagcgagtttaaccaaggta
cctttgctttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system