KEGG   Campylobacter jejuni RM1221: CJE1594Help
Entry
CJE1594           CDS       T00227                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00010  Glycolysis / Gluconeogenesis
cjr00030  Pentose phosphate pathway
cjr00051  Fructose and mannose metabolism
cjr00052  Galactose metabolism
cjr00230  Purine metabolism
cjr00500  Starch and sucrose metabolism
cjr00520  Amino sugar and nucleotide sugar metabolism
cjr00521  Streptomycin biosynthesis
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01120  Microbial metabolism in diverse environments
cjr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJE1594 (algC)
   00030 Pentose phosphate pathway
    CJE1594 (algC)
   00051 Fructose and mannose metabolism
    CJE1594 (algC)
   00052 Galactose metabolism
    CJE1594 (algC)
   00500 Starch and sucrose metabolism
    CJE1594 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJE1594 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJE1594 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJE1594 (algC)
Enzymes [BR:cjr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJE1594 (algC)
    5.4.2.8  phosphomannomutase
     CJE1594 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: AAW36027
Position
complement(1494240..1495610)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIKIYDIGLAPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GVELKEFSKEVYKHLNDDIEENLEVEKYDILSLYVKFICEQFSFLKDFNYKFGVDCTNGA
AGVVIEPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFD
GDADRMVALSKTHVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIRALPK
LYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERAKELESMVFTLFDDIKARFKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatatgatataagaggactttatggcaaagaactgaat
gaaaaaagcgttaaagctataggtttttgcttgggacaaaccatgctaaataaaggctgt
aaaaatgtaagtgtgggctatgatgcaagatatagtgcaaatgagctttttaattatctg
gtgagtggacttaacaaagcgggaataaaaatctatgatatagggcttgcgccaactcca
ttggggtattttagtctttatgagggcttgaaatttgatgcaaatgttatgataacaggc
tctcataacccaaaagattataatggttttaaaatcactatcaataaagaaagttttttt
ggcgtagagttaaaagagttttcaaaagaagtttataagcatttaaatgatgatattgaa
gaaaatttagaagtagaaaaatacgatattttaagcctttatgtgaaatttatatgtgag
caatttagctttttaaaggattttaattataaatttggtgttgattgtacaaatggtgcg
gctggagtagtgatagagcctttaatcaaggctttaaatttaaaagctcatgtaatgttt
gcagagcctgatggacagtttccaaaccatgccccagatcctacagaagaagaaaactta
agtgcgattagagaatttttaaatcaaaatcaagattattctttggcttttgcttttgat
ggggatgctgatagaatggttgctttaagtaaaactcatgtattttgtggggatgagctt
tgttatttgtttgctaaaaatatccctaatccacgcattttaggcgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagctgctgaggtgagtggg
catattttctttaaacatagatattttggttatgatgatggaatttatgcatttttaaga
gccttggagcttgtttataaaggttttgatctagaaagtatgattagagctttaccaaaa
ctttatactacacctgaaattaaaattcctgtaaatgaagaagaaaaattcaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggtgttaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttacttcgtgcatctaacacc
agcccttatcttatcacacgctttgaggcaacgtctttagaaagagcaaaagagcttgaa
agtatggtatttactttatttgatgatataaaagctagatttaagaattga

DBGET integrated database retrieval system