KEGG   Campylobacter jejuni RM1221: CJE1707Help
Entry
CJE1707           CDS       T00227                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CJE1707 (galU)
   00052 Galactose metabolism
    CJE1707 (galU)
   00500 Starch and sucrose metabolism
    CJE1707 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CJE1707 (galU)
Enzymes [BR:cjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CJE1707 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1606369..1607193)
Genome map
AA seq 274 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMENMGFVTGRGKR
ALEDYFDISYELEHQISGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGRPLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVISGNFVEE
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTKAGKNGEVQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFYEKSKC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtattttccctgcggcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaaccaagcctttgatccattatggagtt
gatgaagctttagaagcaggaatggaaaatatgggatttgtcacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgaacatcaaatttcaggtacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgtacctttacttttaca
agacaaaatcaaatgaaaggcttaggtgatgcggttttaaaaggtagacctttggttggc
gatgaagcttttggcgtaattttggctgatgatttgtgtgttaatgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagagcaagtttcaaactatggagtaatttctggaaattttgtagaagaa
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
aaagcgggaaaaaatggtgaagtccaacttaccgatgcgcttttaactcaagcaactaat
ggtatggttttagcttataaatttcaaggaaaacgctttgattgtggaagtgtagaaggc
tttgtagaagcgacaaattatttttacgagaaaagtaaatgttaa

DBGET integrated database retrieval system