KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0020Help
Entry
CJS3_0020         CDS       T01856                                 

Gene name
ccpA-1
Definition
Cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23560..24474)
Genome map
AA seq 304 aa AA seqDB search
MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMDKSLSKDGKVSCNTCH
RLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRAKDLTEQAMGPFFNPKE
MGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAIAEFEKTLITPNSPFDRYLSGDQ
NAISTQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEYPNQEDLGRYEITKREADK
MVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKFLDQETVDNIVAFLESLTGE
YHDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatgattttatgtttatcttatgcaaatatagtctttgcagtagat
atgataacccctattccaaattccatctcttatgataaagaaaaagctaaacttggaaaa
agtctttatatggataaaagtttatccaaagatggaaaagtttcgtgcaatacttgccat
aggcttgatcaacacggtgttgatgggcttgaattttcaataggagttgataatcaactc
gataaaccctttaacactcctacaacctttaattctgtgtttaattttgtgcaattttgg
aatggcagagctaaagatttaacagaacaagctatgggaccttttttcaatccaaaagaa
atggggctaagtcctgaacttcttttacaaaaagttaattcaaatgaaaattatgtaaaa
acttttaaaaaactttatggagaagttacggtagaaaacatagctcttgcaatcgccgaa
tttgaaaaaaccttgatcactccaaattctccttttgatcgctatcttagcggggatcaa
aatgctatttcaactcaagctaaaaaaggttacgaagattttaaagctaatggctgcatc
tcttgtcatcaaggtcaaaatataggtgggaatatgtttcaaaaaatcggtatttttgaa
gaatacccaaaccaagaagatttagggcgctatgaaatcacaaaaagagaagctgataaa
atggtatttaaagttcctagtcttagaaatatagccaaaaccgcgccttattttcatgat
ggttctatacctactttagatgcttgtgttcagtttatggcttactatcaactaggaaaa
tttttagatcaagaaacagttgacaatatagttgcattcttagaaagcttaacaggagaa
tatcatgacaaataa

DBGET integrated database retrieval system