KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0065Help
Entry
CJS3_0065         CDS       T01856                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(77070..77543)
Genome map
AA seq 157 aa AA seqDB search
MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRFDMLFRVMMDDKRFKI
LSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKNAPRTL
DLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattcaaggagtaaaacactttgaaaaaagtcgtttttttcctttttttagt
caaaatatacgatcttttaaatatttagctcttataggcttaggaagcaatatagagccc
gaaaaaaaaagatttgatatgctttttcgagtaatgatggatgataaaagatttaaaatt
ttatccacatctcctatgttgataaatgaagcctttggttttaaagagcaaaaagatttt
accaatgctgttatgttgatacaaactaatttgcatgcacgagcacttttgaaagtttta
ctttattatgaagtaaaatttaaacgcaagagaactttcaaaaacgctcctagaacgctt
gatttagatcttttatacttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcct
cataaaggggctaaagaaagagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system