KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0096Help
Entry
CJS3_0096         CDS       T01856                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJS3_0096 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CJS3_0096 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CJS3_0096 (proB)
Enzymes [BR:cjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CJS3_0096 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
104245..105000
Genome map
AA seq 251 aa AA seqDB search
MKRIVVKVGSHVISEENTLSFERLKNLVAFLAKLMEKYEVILVTSAAISAGHTKLDIDRK
NLINKQVLAAIGQPFLISVYNELLAKFNKLGGQILLTGKDFDSRKATKHAKNAIDMMINL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFDVDLLVILSDIDGFYDKNPSEFSDAKR
LEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGFDLSVAKTFLL
EDKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagttgttaaagtgggttctcatgtgattagcgaagaaaacactttaagt
tttgagcgtcttaaaaatttagtcgcatttttagctaaactcatggaaaaatatgaagta
attttagtaacctcggcggctatttcggcaggacacaccaaactagatatcgatagaaaa
aaccttattaataaacaagttttagctgctattggacaaccttttttaatcagtgtttat
aacgagcttttagccaaatttaacaaactaggcggacaaattttacttacaggcaaggat
tttgactctagaaaagctactaaacacgcaaaaaatgctatcgatatgatgataaattta
ggaattttacctattatcaatgaaaatgacgctacagctatagaagaaattgtctttggt
gataatgatagtttaagtgcttatgctacgcatttttttgatgtggatttgcttgtgatt
ttaagcgatattgatggattttacgataaaaatcctagtgaatttagtgatgcaaagcgt
ttagaaaaaatcactcatattaaagaagaatggctacaagcaaccataaaaacaggtagt
gagcacggaacaggtggtatagtaaccaaacttaaggcagctaaatttttacttgaacac
aataaaaaaatgtttttagcaagtggctttgatttaagtgtggcaaagacatttttatta
gaagataaacaaataggtggaactttgtttgagtga

DBGET integrated database retrieval system