KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0190Help
Entry
CJS3_0190         CDS       T01856                                 

Gene name
folE
Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
186908..187480
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLASGYTQNVKDILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGIQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaaccatacttgaaattataggagaaaatcca
aatcgtgaagggcttattaaaacaccaaatcgtgtttttaaagcttatgaatttcttgct
agtggttatacgcaaaatgtcaaagacattttaaatgatgctttatttgaaagctctaat
aatgaaatggttttggtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatatccctaataaaaaagtagtaggtttaagc
aaaattccacgccttgtagaagtgtttgcaagaagacttcaaattcaagaacaacttact
gaacaaatcgcacaagctttaatggaaaatgttgatgcaaaaggtgtgggtgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggaatacaaaaagctaattccaccactaca
acttcagctttacgtggaattttcttaaaaaatgaaaaaaccagagaggaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system