KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0340Help
Entry
CJS3_0340         CDS       T01856                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cjs01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cjs00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cjs00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
319620..320369
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattggatcaaagccctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggcgtggatattcatagtgtttttgagcttttagct
aggataaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttaattaaagagtgtgaaagatataatatagct
ttaattacacttgtaagtgttacaacccctaaagaaagggttaaaaagttagtaaaacat
gctaaaggttttatttatttattagcaagcataggtattacaggtacgaaaagtgtcgaa
gaagcaatcttacaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggctttggcattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgacgga
gtgattgtgggaactagcatagtaaagtgttttaaacaaggaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system