KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0349Help
Entry
CJS3_0349         CDS       T01856                                 

Gene name
ccpA-2
Definition
Cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Brite
Enzymes [BR:cjs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CJS3_0349 (ccpA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325644..326669
Genome map
AA seq 341 aa AA seqDB search
MKVKALLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKA
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGVSTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaagcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttgccaaaagatcaaaaaggt
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagca
gagcttggcaaaaagctttattttgaaccacgcctttcaaaaagtggtatcatttcttgt
aatacctgtcacaatgtaggacttggtggaacagatggggttagtactgcaataggtcat
aaatggacagcaaatccccatcatttaaattcaccaacagtttataatgcggttttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaactcgcagtagaaaaaatttcatcattg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagtggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaaccttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagagcaaaaaggcttaaagcttttt
atagacaagggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggcgctatttggaatctaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatccttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

DBGET integrated database retrieval system