KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0575Help
Entry
CJS3_0575         CDS       T01856                                 

Definition
Alternative dihydrofolate reductase 2 / Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542246..543388
Genome map
AA seq 380 aa AA seqDB search
MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDISTPAANILKQDALRVGA
ELITHKEVITAKITHSNALLMASKEQIQKLVVKEKLQDFGLKNLALFLQKDFLKQKKAEL
MAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVSSRPGSEYCGKEEEFKRL
KKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDITSLRNLNLAKLASKYGAK
YCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFGVKESILDVGIGFGKSAGHN
MILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLAGTLYLHLKAFENGASIIRVH
DLYEHKQLFALAQAMDNIGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttaaaatcaatccaaataccgattttaatttgctttgttctttcataaat
ccccataaaatgggacaaaaaattatgagtgaaaaaacaaaaattcattttatttttatc
aaagatatttccactcctgcggcaaatattttaaaacaagatgctttaagagtaggagct
gaacttattactcataaagaagtaattactgcaaaaatcactcattcaaatgcgctttta
atggcaagtaaagagcaaattcaaaagcttgttgtcaaagaaaaacttcaagattttgga
cttaaaaatttggctctttttttgcaaaaagattttttaaaacagaaaaaagccgagctt
atggcagtgattaatgtcaatgaagacagttttaatgcaaaaagtcgtgtgagtgaagaa
gactttgaaaaaaggcttaatgactttcttgctttaaagcctgaatatatcgatataggt
gcggtaagttcaagacctgggagtgagtattgtggcaaggaagaggaatttaaaagactg
aaaaaagtacttgacttaatttatgagaaaaattattacgaacaagcaatttttagttta
gatagttttgatgaatattgtctagaatatgctttaaataagggttttaaactcattaat
gatattacaagtttaagaaatcttaatctagccaaacttgcaagtaaatatggggcaaaa
tattgcttaatgcacatgcaaaacaatccaaataacatgcaagataatcctttttatgaa
gatttgcttgatgagatgactttgttttttaaagaaaaacttgagcttttagaaagtttt
ggagtaaaagaaagtattttagatgtaggtattggttttggaaagagtgcggggcataat
atgattttaatcaaacacttagaacattttttgcaatttaataaacctttacttataggt
gcgagtcgtaaaagtgtgattaatgcgtattttcaaagcgagattaaagatcgtttagcg
ggaactttatatttgcatttaaaggcttttgaaaatggtgctagtattataagagtgcat
gatttatatgagcataaacaactttttgctttagcgcaggcaatggataatataggagtt
tag

DBGET integrated database retrieval system