KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_0966Help
Entry
CJS3_0966         CDS       T01856                                 

Gene name
cheB
Definition
Protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CJS3_0966 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CJS3_0966 (cheB)
Enzymes [BR:cjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CJS3_0966 (cheB)
Two-component system [BR:cjs02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CJS3_0966 (cheB)
Bacterial motility proteins [BR:cjs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CJS3_0966 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(892204..892758)
Genome map
AA seq 184 aa AA seqDB search
MKLILIGSSTGGPNQLKFLLKDIDVKNTCVVIAQHMSASFIPSFVGQFNKEAFSEVCLLN
DKEILSNKIYICPKNTILSGNLNIVAAWQDVASSFKPSVDLLFHSAVSLAKTNKILAIIL
TGMGDDGAKGLFELYKTGVRCLCENEADSVVYGMPKRAKDMNPHLKPMSLKEIKKEIVNF
IDQD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcatactcataggatcttcaacaggtggtcctaatcagcttaaatttctttta
aaggatattgatgtaaaaaatacttgtgtagttatagctcagcacatgagtgccagtttt
attccatcttttgtggggcaatttaataaagaagcttttagtgaagtgtgcttattgaac
gataaagagatattaagcaataaaatttatatttgccctaaaaatactattttatctgga
aatttaaatattgtagccgcttggcaagatgtggcttcaagctttaaaccgagtgtggat
ttactttttcattccgctgtttctttggcaaaaacaaataaaatacttgctattatttta
acgggcatgggagatgatggcgcaaaaggtttatttgagctttataaaacaggagttaga
tgtttatgtgagaatgaagcagatagcgtcgtttatggtatgccaaaaagagcaaaagat
atgaatccgcatttaaaacctatgagcttaaaagaaattaaaaaagaaattgtaaatttt
attgatcaggattaa

DBGET integrated database retrieval system