KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1044Help
Entry
CJS3_1044         CDS       T01856                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cjs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(958108..959091)
Genome map
AA seq 327 aa AA seqDB search
MFKRFRRLRLNENLRAMVRENSLSVNDLIYPLFVVNGTGIKKEISSMPDVFQMSLDEILK
ECQNVVNLGIKAIILFGVLENEKKDSCGSDALDDEGLVARSIREIKKNFPDLFIISDLCF
CEYTDHGHCGIIDPKTKSVDNDVTLEISAKQALVHARAGVDMIAPSGMMDGIITTLRKAL
DKEGFENLPIMAYSTKFASSYYGPFRDVAESAPSYGDRKSYQMDFANGKEALEESLEDEA
QGADILMVKPALAYLDVVKEISLHSNLPLCVYNVSGEYAMLKAAKNAGVIDYEKVLYETM
IAFKRAGAKLIITYHAKELAKMLKGEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagattaaggcttaatgaaaacttaagagccatggtaagagaa
aattctttaagtgtaaatgatttgatttatccgctttttgtggttaatggaacggggata
aaaaaagaaatttcttctatgcctgatgtgtttcaaatgagtttagatgaaattttaaaa
gagtgtcaaaatgtagttaatttaggcattaaagccattatactttttggcgttttggaa
aatgagaaaaaagacagctgtggaagcgatgctttagatgatgaagggcttgttgcaaga
agtataagagagattaagaaaaattttccagatctttttataatcagtgatctttgtttt
tgtgaatacacagatcacgggcattgtgggattatcgatccaaaaacaaaaagtgtggat
aatgatgtcactttagaaatttcagccaaacaagccttagttcacgcaagagcaggggta
gatatgatagcacctagtggaatgatggatggtattatcactactttgcgcaaagcttta
gataaagaaggttttgaaaatttgcctataatggcgtattctactaaatttgcttcaagt
tattatgggccatttcgagatgtagcagaatcagctccaagttatggagatagaaaaagc
tatcaaatggattttgctaatggtaaagaagctttagaagaaagcttggaagatgaagca
caaggagctgatattttgatggtaaaacccgctcttgcttatcttgatgtggttaaagaa
atatcccttcattctaacttgcctttgtgtgtttataatgtaagcggagagtatgctatg
ttaaaggcagctaaaaatgcaggagtgattgattatgaaaaagttttgtatgaaactatg
atagcttttaaaagagcaggggcaaagcttatcatcacttatcatgccaaagaattagct
aaaatgttaaaaggagaaaaatga

DBGET integrated database retrieval system