KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1097Help
Entry
CJS3_1097         CDS       T01856                                 

Gene name
dapE
Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJS3_1097 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CJS3_1097 (dapE)
Enzymes [BR:cjs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CJS3_1097 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1012492..1013589)
Genome map
AA seq 365 aa AA seqDB search
MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIKNLLLTKKFKDEGEHL
AFGGHVDVVPAGEGWSSDAFVPMEKEGFIYARGAQDMKSGVAAFVDAVKNADFKGARLSL
ILTSDEEGEAIYGTKAVLEWMQERDMLPDYAVVAEPTCVKKIGDSIKIGRRGSINGKLLI
RGKQGHAAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVITDIRGGMGVCNVTP
NDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSSEAFLTNIDNKIVQKMNESV
QKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKD
LIENF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaagaatttttaatcgaacttttaaaatttaaatctgttacgccaaatgat
gatggagctttaaatttcatcgctatggaactgagtgattttgaagctttttttatagaa
aaagaaggcattaaaaaccttttactcactaaaaaatttaaagatgaaggcgagcattta
gcttttggtgggcatgtagatgtggtgcctgcaggtgagggttggagtagcgatgctttt
gtgcctatggaaaaagaaggctttatctatgcaaggggtgctcaagatatgaaaagcgga
gtagcagcctttgtagatgcggtaaagaatgcggattttaaaggagctagacttagcctt
attttaacaagtgatgaagaaggcgaagctatatatggaactaaggctgttttagaatgg
atgcaagaaagagatatgctacctgattatgctgtggttgccgagccaacctgcgttaaa
aaaatcggcgatagtattaaaatagggcgtcgtggttctatcaatggaaaacttttaatc
cgtggaaaacaagggcatgcggcttaccctgaaaaatgtatcaatcctgtgcatgatttt
gcgccagttttaaagcttttagcgggttttgatcttgatcctggaagtgctgaatttagt
ccttcaaaaatcgttataactgatattcgcggaggtatgggggtgtgtaatgttacgcca
aatgatttaaaacttatgtttaatgttcgcaattcccctgatacaagcttagaagatgta
aaaagttatgtagaaaaaatttgtcatggtttaaactatgagttagagctaaaacaatca
agcgaagcttttttgacaaatatcgataataaaatcgttcaaaaaatgaatgaaagcgtt
caaaaaatcacccatgaagtgccagagcttaatactaaaggcggcacaagtgatgcaagg
tattttgcaaaatacggtgtaaaggtagtggaatttggggtttgtaatgatagaattcac
gctattgatgaaagagtaagtatagaagaatttgaaaaactttgccttgtttttaaagac
ttgatagaaaatttttaa

DBGET integrated database retrieval system