KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1127Help
Entry
CJS3_1127         CDS       T01856                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00860  Porphyrin and chlorophyll metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CJS3_1127 (hemD)
Enzymes [BR:cjs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CJS3_1127 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADT72850
Position
complement(1042172..1042801)
Genome map
AA seq 209 aa AA seqDB search
MKIYLLNETPFEGVENLILNEIVFYDFSVDLSLYDALICTSKNALKALQHAKITLNFKLN
LYAVGQSTAQYAKNLGFKKIKIPSKAYGKDLFLEFKEELKMQKCLYLRAKNIVSTLNLDL
KNVGVDLDEMIVYENVFKKGDKKLIYPAIFIFTSPLSVENFLKFYSLKEEDKVVVIGQST
AKKLLNFKNLYICENQSLLDCVKLAKTLV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatctcttaaatgaaactccttttgaaggggtggaaaatcttattttaaat
gagattgttttttatgattttagtgtggatttgagtttgtatgatgctttaatctgcact
tcaaaaaatgctttaaaagctttacaacatgcaaaaatcactttaaatttcaaactcaat
ttatacgctgtgggacaaagtacagctcaatacgctaaaaatttaggttttaaaaagatt
aaaattccatcaaaggcttatggaaaagatctttttcttgaatttaaagaggagttaaaa
atgcaaaaatgtttgtatttaagggctaaaaatattgtttcaactttaaatttggatctt
aaaaatgtaggtgtggatttagatgaaatgattgtttatgaaaatgtttttaaaaaaggc
gacaaaaagcttatctatcctgctatttttatattcacctctcctttaagtgtagaaaat
tttttaaaattttatagcttaaaagaagaagataaggttgtagttatagggcaaagcaca
gcaaagaagcttttaaattttaaaaatctttatatatgcgaaaatcaaagtcttttagac
tgtgttaagctcgctaagactttggtttaa

DBGET integrated database retrieval system