KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1145Help
Entry
CJS3_1145         CDS       T01856                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CJS3_1145 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CJS3_1145 (pyrB)
Enzymes [BR:cjs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CJS3_1145 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1062212..1063099
Genome map
AA seq 295 aa AA seqDB search
MRHLITTKDFNKVEIMELFKEASDFLDEKPRTFLEGKSITTIFFENSTRTLSSFESAARR
LGARVLRLDVSRSSSSKGETLYDTAANLDAMSPNAIVVRHANSGVPLILAKHMHCPVVNG
GDGKHAHPTQALLDLFTIYNHFQGNVEGKKICIVGDIKNSRVAASNIELLSRFNLDITLV
APPHFMPNTHLKKHYKLDENIIANSDIIMSLRTQTERHNKTVYASLKDYANDFCIQKSLA
KDKKLILLHPGPVNRNIDISDEMMSDERTLVLKQVKNGVAIRMAVLKKLILENEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcactacaaaggattttaataaagtcgaaattatggagctttttaaa
gaagcaagtgatttcttagatgaaaaacctaggacttttcttgaaggaaaaagcatcacg
acaattttttttgaaaactctacacgcaccctttcatcttttgaaagcgctgcaagaaga
ttaggtgctagggttttacgccttgatgtttcaagatcaagctctagcaaaggagaaact
ctttatgatactgctgctaatttagatgccatgagtcctaatgctattgttgtaagacac
gcaaactcaggagttcctttgatattagcaaagcatatgcattgtccagttgttaatgga
ggagatggaaaacacgcccatcctacccaagctttactcgatttgtttacgatttataat
cattttcaaggtaatgttgaaggtaagaaaatttgcatcgtaggtgatattaaaaactct
cgtgtagcagcgtccaatatagagcttttaagtagatttaatcttgatattaccctagta
gctccaccacattttatgcctaatacccatcttaaaaaacattataagcttgatgagaat
atcatagcaaattcagatattatcatgagtcttagaacacaaacagaaagacataataaa
accgtttatgcttcacttaaagactatgcaaatgatttttgcattcaaaaaagcttagca
aaagataaaaagcttattttactacatccaggccctgtaaatcgcaatattgacataagc
gatgaaatgatgagcgatgaaaggactttagttttaaaacaagttaaaaatggagtggcc
attagaatggctgttcttaaaaaactcatattagaaaatgaaggataa

DBGET integrated database retrieval system