KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1219Help
Entry
CJS3_1219         CDS       T01856                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00230  Purine metabolism
cjs01100  Metabolic pathways
Module
cjs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CJS3_1219
Enzymes [BR:cjs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CJS3_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 ABC_tran RsgA_GTPase MMR_HSR1 AAA_22 Rad17 AAA_29 AAA_14 AAA_19 NTPase_1 KAP_NTPase RNA_helicase ATPase_2 Thymidylate_kin RepB-RCR_reg AAA AAA_17 NACHT NB-ARC DUF2075 cobW AAA_30 T2SSE CSF-1 Cytidylate_kin dNK Methyltransf_12 Zeta_toxin AAA_24 Viral_helicase1 APS_kinase TsaE AAA_28
Motif
Other DBs
NCBI-ProteinID: ADT72938
Position
complement(1128461..1129078)
Genome map
AA seq 205 aa AA seqDB search
MQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEF
QKGIDSDHFLEWARVHENFYGTSLKHTQNALDNGKIVVFDIDVQGFKIARKKMADKIVSV
FITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYDYLIINDELKQSYEALRA
ILIAHKFRTKGQNLGQIQNIWNEGE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggttttgttttgttgatttcaggtcctagtggtgctggaaaatcaactctttta
aaaaaactttttgatgaatttgaagatgagctttatttttctatttcttcaacaactcgc
aaaccaagagagggtgaaaaaaatggaatacattatcattttatatcccatgaagaattt
caaaaaggtatagatagtgatcattttttagaatgggctagagtgcatgaaaatttttat
ggtacttctttaaagcacactcaaaatgctttagataatggaaaaatagttgtttttgat
attgatgtgcaaggatttaaaatagccagaaaaaaaatggctgataagattgtttctgtt
tttattactacaaaaaataaagatgagttaaaaaaaagacttattaagcgaaatactgat
acaataatacaactagaaaaaagattacaaaacgctagtgatgagatgaaagagcttagc
gagtatgattatcttatcattaacgatgagttaaagcaaagttatgaagcattgcgagcg
attttaatcgcccataaatttagaaccaaagggcagaatctagggcaaattcaaaatatt
tggaatgaaggagaataa

DBGET integrated database retrieval system