KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1446Help
Entry
CJS3_1446         CDS       T01856                                 

Gene name
pldA
Definition
(GenBank) Phospholipase A1 precursor; Outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00564  Glycerophospholipid metabolism
cjs00565  Ether lipid metabolism
cjs00592  alpha-Linolenic acid metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJS3_1446 (pldA)
   00565 Ether lipid metabolism
    CJS3_1446 (pldA)
   00590 Arachidonic acid metabolism
    CJS3_1446 (pldA)
   00591 Linoleic acid metabolism
    CJS3_1446 (pldA)
   00592 alpha-Linolenic acid metabolism
    CJS3_1446 (pldA)
Enzymes [BR:cjs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CJS3_1446 (pldA)
    3.1.1.32  phospholipase A1
     CJS3_1446 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 TPR_7 MIT Aida_N TPR_2 TPR_6 TPR_8 TPR_1
Motif
Other DBs
NCBI-ProteinID: ADT73151
Position
1339109..1340098
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLSLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSEA
TQMQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGTNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYKHSSPFRETNYQPEFFIDLPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPENKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHNNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaagcttatgcgtttttatatgggctagtgatttacaa
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaataactcaagcgaagca
acacaaatgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagttttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggaacaaataataat
aagagtgaggcgaaatttcaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttataagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagatcttcctttatat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctactgctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaaacaaaaaa
gatgatgataatcctgccatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttaggtgatgattattttatcaatcttatgctaagaaataatcttaaattccacaataat
aaaggcgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttacaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system