KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1477Help
Entry
CJS3_1477         CDS       T01856                                 

Definition
Putative periplasmic protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Brite
Enzymes [BR:cjs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CJS3_1477
Secretion system [BR:cjs02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CJS3_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1377494..1378204
Genome map
AA seq 236 aa AA seqDB search
MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVE
LNGQKQENILFTKDSLITPDLIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMV
IALGDKNKPAIYVFSDPECPYCREHLAQIDNELKNYQVNYILTPVHGKSAFEKSALIYKE
AKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaagtttaattcttgcctgttcggcatctttgtttgctgcaagtaattca
gaaattagtgatttttattcaaaaagcattaaagcacaatttccaaatgctaccgttagt
gtatcaaatcgtcaaaaggttggtaatacgggttttgaaagtgttattgtaagcgttgaa
ttaaatggacaaaaacaagaaaacattctttttacaaaagatagtcttattacccctgat
cttatcgacttgaaaacgggaatttcttatgctcaagaatatgaaatgaaaaaatttcaa
gaagcaagagaaaattttacaaaaaatgctaaagctgtagcacaaaaagaaaccatggta
atagctttaggagataaaaataaacccgcaatttatgttttttcagatcctgaatgccca
tattgtagagaacatttagctcaaattgataatgaacttaaaaactatcaagttaattat
attttaactccagtacatggaaaatctgcctttgaaaaatccgctctaatctacaaagaa
gcaaaaaaagcaaaaaatgacaaagaaaaaatcgcaattttaaacaaatactatgatgca
aatatcaaaaattatccaaaagtaagcgatgcagaattaaaagaagttttttccttatat
gaaaaatatcgctcattaggtcttagcgctactccaactattattaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system