KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1496Help
Entry
CJS3_1496         CDS       T01856                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
cjs00010  Glycolysis / Gluconeogenesis
cjs00051  Fructose and mannose metabolism
cjs00562  Inositol phosphate metabolism
cjs01100  Metabolic pathways
cjs01110  Biosynthesis of secondary metabolites
cjs01120  Microbial metabolism in diverse environments
cjs01130  Biosynthesis of antibiotics
cjs01200  Carbon metabolism
cjs01230  Biosynthesis of amino acids
Module
cjs_M00002  Glycolysis, core module involving three-carbon compounds
cjs_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJS3_1496 (tpiA)
   00051 Fructose and mannose metabolism
    CJS3_1496 (tpiA)
   00562 Inositol phosphate metabolism
    CJS3_1496 (tpiA)
Enzymes [BR:cjs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CJS3_1496 (tpiA)
Exosome [BR:cjs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CJS3_1496 (tpiA)
  Exosomal proteins of bladder cancer cells
   CJS3_1496 (tpiA)
  Exosomal proteins of melanoma cells
   CJS3_1496 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BtpA
Motif
Other DBs
NCBI-ProteinID: ADT73199
Position
complement(1393408..1394079)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAEILNKTMGAKCDDIIVFPPSVAFLENENNFIQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagagcaagctttaaaatttatgct
gaaattttaaataaaaccatgggagcaaaatgtgatgatattatcgttttcccacctagt
gtagcatttttagaaaatgaaaataacttcatacaaggagcgcaaaatttttatccttgt
gttaatggtgcttttacaggcgagcttggaaaagagcatttggacgaatttgggatcaaa
tgtgttttaatcgggcattctgaaagaagagctttaggagatgaagaatttattaaggct
aaatttgattttgctaaagagcatggttataaaattgttttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agcgcacaaagtacagatatcgctaaagtgcttgaatttttagcgagtttaaccaaggta
cctttgctttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system