KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1502Help
Entry
CJS3_1502         CDS       T01856                                 

Gene name
algC
Definition
Phosphomannomutase / Phosphoglucomutase / Phosphoglucosamine mutase (EC:5.4.2.2 5.4.2.10 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJS3_1502 (algC)
   00030 Pentose phosphate pathway
    CJS3_1502 (algC)
   00051 Fructose and mannose metabolism
    CJS3_1502 (algC)
   00052 Galactose metabolism
    CJS3_1502 (algC)
   00500 Starch and sucrose metabolism
    CJS3_1502 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJS3_1502 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJS3_1502 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJS3_1502 (algC)
Enzymes [BR:cjs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJS3_1502 (algC)
    5.4.2.8  phosphomannomutase
     CJS3_1502 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1397694..1399064)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIKIYDIGLAPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GVELKEFSKEVYKHLNDDIEENLEVEKYDILSLYVKFICEQFSFLKDFNYKFGVDCTNGA
AGVVIEPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFD
GDADRMVALSKTHVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIRALPK
LYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERAKELESMVFTLFDDIKARFKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatatgatataagaggactttatggcaaagaactgaat
gaaaaaagcgttaaagctataggtttttgcttgggacaaaccatgctaaataaaggctgt
aaaaatgtaagtgtgggctatgatgcaagatatagtgcaaatgagctttttaattatctg
gtgagtggacttaacaaagcgggaataaaaatctatgatatagggcttgcgccaactcca
ttggggtattttagtctttatgagggcttgaaatttgatgcaaatgttatgataacaggc
tctcataacccaaaagattataatggttttaaaatcactatcaataaagaaagttttttt
ggcgtagagttaaaagagttttcaaaagaagtttataagcatttaaatgatgatattgaa
gaaaatttagaagtagaaaaatacgatattttaagcctttatgtgaaatttatatgtgag
caatttagctttttaaaggattttaattataaatttggtgttgattgtacaaatggtgcg
gctggagtagtgatagagcctttaatcaaggctttaaatttaaaagctcatgtaatgttt
gcagagcctgatggacagtttccaaaccatgccccagatcctacagaagaagaaaactta
agtgcgattagagaatttttaaatcaaaatcaagattattctttggcttttgcttttgat
ggggatgctgatagaatggttgctttaagtaaaactcatgtattttgtggggatgagctt
tgttatttgtttgctaaaaatatccctaatccacgcattttaggcgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagctgctgaggtgagtggg
catattttctttaaacatagatattttggttatgatgatggaatttatgcatttttaaga
gccttggagcttgtttataaaggttttgatctagaaagtatgattagagctttaccaaaa
ctttatactacacctgaaattaaaattcctgtaaatgaagaagaaaaattcaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggtgttaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttacttcgtgcatctaacacc
agcccttatcttatcacacgctttgaggcaacgtctttagaaagagcaaaagagcttgaa
agtatggtatttactttatttgatgatataaaagctagatttaagaattga

DBGET integrated database retrieval system