KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1723Help
Entry
CJS3_1723         CDS       T01856                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cjs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cjs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1610549..1611763
Genome map
AA seq 404 aa AA seqDB search
MQTTQNAKFHAQALEKGAKIIDVNECKKLLKIDEKIQIIGITGTNGKTTTAAAIYSILLD
LGYKCGLCGTRGAFINDEQIDEKSLTTSPILKTLEYLQIATQKKCDFFIMEVSSHALIQN
RIEGLNFAAKIFTNITQDHLDFHGTFENYKEAKELFFTDESLKFINKDALAIKFNVRNAF
TYGIENPALYQIKAYSLEEGISAIVTNKNQTFHIDSPLLGLFNLYNLLVASACVNELVKP
DLKDLEKAISGFGGVCGRVEQVAKGVIVDFAHTPDGIEKVLDTLKNKKLIVVFGAGGDRD
KTKRPLMGKIVEHFAKIAIITSDNPRSEEPKTIMEEILSGFTKKEKVLMIEDRKEAIKKA
LELKENDDLVVILGKGDETTQEIKGIKYPFSDKVVVNEILKNQG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaccacacaaaatgctaaatttcacgctcaagccttagaaaaaggtgcaaaaatc
attgatgtaaatgagtgtaaaaaacttttaaaaatcgatgaaaagattcaaatcatagga
atcacaggaaccaatggcaaaaccacaaccgcagcagcgatttattctatcttattggat
ttaggttataagtgtgggctttgtgggacaagaggagcttttatcaacgatgaacaaatc
gatgaaaaatccttaaccacctcccctattcttaaaaccttagaatacctacaaatagcc
actcaaaaaaaatgtgattttttcatcatggaagtaagctcacacgccttaattcaaaac
cgcatcgaaggcttaaattttgctgctaaaatttttaccaatatcactcaagatcattta
gattttcacggtacttttgaaaattataaagaagcaaaagaacttttttttaccgatgag
agtttaaaatttatcaacaaagatgctttggctattaaatttaatgtgcgtaatgctttt
acttatggcatagaaaatcctgctttatatcaaatcaaagcttattctttagaagaaggc
attagtgctattgtaacaaataaaaatcaaacttttcacatagactcgcccttgctagga
ctttttaatctttacaatcttctagttgctagtgcttgtgtgaatgaactcgtaaagcct
gatttaaaagacttggaaaaagctatcagtggatttggcggggtttgtggcagggtagaa
caagtagcaaaaggtgtgattgtagattttgctcatacgcctgatggcattgaaaaagtg
cttgacactcttaaaaataaaaaactcatcgttgtttttggagcaggtggagatagagat
aaaaccaaacgccctttaatgggaaaaatcgtcgaacattttgcaaaaattgctatcatt
acaagtgacaatccacgcagcgaagaaccaaaaaccatcatggaagaaattttatcaggc
tttactaaaaaagaaaaagttttaatgatagaagatagaaaagaagctataaaaaaagct
ttagaactaaaagaaaatgacgatttagtcgttattttaggcaaaggtgatgaaactact
caagaaattaaagggataaaatatccttttagtgataaagtagttgttaatgaaatttta
aaaaatcaaggataa

DBGET integrated database retrieval system