KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1723Help
Entry
CJS3_1723         CDS       T01856                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cjs00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CJS3_1723 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CJS3_1723 (murE)
Enzymes [BR:cjs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CJS3_1723 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1610549..1611763
Genome map
AA seq 404 aa AA seqDB search
MQTTQNAKFHAQALEKGAKIIDVNECKKLLKIDEKIQIIGITGTNGKTTTAAAIYSILLD
LGYKCGLCGTRGAFINDEQIDEKSLTTSPILKTLEYLQIATQKKCDFFIMEVSSHALIQN
RIEGLNFAAKIFTNITQDHLDFHGTFENYKEAKELFFTDESLKFINKDALAIKFNVRNAF
TYGIENPALYQIKAYSLEEGISAIVTNKNQTFHIDSPLLGLFNLYNLLVASACVNELVKP
DLKDLEKAISGFGGVCGRVEQVAKGVIVDFAHTPDGIEKVLDTLKNKKLIVVFGAGGDRD
KTKRPLMGKIVEHFAKIAIITSDNPRSEEPKTIMEEILSGFTKKEKVLMIEDRKEAIKKA
LELKENDDLVVILGKGDETTQEIKGIKYPFSDKVVVNEILKNQG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaccacacaaaatgctaaatttcacgctcaagccttagaaaaaggtgcaaaaatc
attgatgtaaatgagtgtaaaaaacttttaaaaatcgatgaaaagattcaaatcatagga
atcacaggaaccaatggcaaaaccacaaccgcagcagcgatttattctatcttattggat
ttaggttataagtgtgggctttgtgggacaagaggagcttttatcaacgatgaacaaatc
gatgaaaaatccttaaccacctcccctattcttaaaaccttagaatacctacaaatagcc
actcaaaaaaaatgtgattttttcatcatggaagtaagctcacacgccttaattcaaaac
cgcatcgaaggcttaaattttgctgctaaaatttttaccaatatcactcaagatcattta
gattttcacggtacttttgaaaattataaagaagcaaaagaacttttttttaccgatgag
agtttaaaatttatcaacaaagatgctttggctattaaatttaatgtgcgtaatgctttt
acttatggcatagaaaatcctgctttatatcaaatcaaagcttattctttagaagaaggc
attagtgctattgtaacaaataaaaatcaaacttttcacatagactcgcccttgctagga
ctttttaatctttacaatcttctagttgctagtgcttgtgtgaatgaactcgtaaagcct
gatttaaaagacttggaaaaagctatcagtggatttggcggggtttgtggcagggtagaa
caagtagcaaaaggtgtgattgtagattttgctcatacgcctgatggcattgaaaaagtg
cttgacactcttaaaaataaaaaactcatcgttgtttttggagcaggtggagatagagat
aaaaccaaacgccctttaatgggaaaaatcgtcgaacattttgcaaaaattgctatcatt
acaagtgacaatccacgcagcgaagaaccaaaaaccatcatggaagaaattttatcaggc
tttactaaaaaagaaaaagttttaatgatagaagatagaaaagaagctataaaaaaagct
ttagaactaaaagaaaatgacgatttagtcgttattttaggcaaaggtgatgaaactact
caagaaattaaagggataaaatatccttttagtgataaagtagttgttaatgaaatttta
aaaaatcaaggataa

DBGET integrated database retrieval system