KEGG   Campylobacter jejuni subsp. jejuni S3: CJS3_1760Help
Entry
CJS3_1760         CDS       T01856                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cjs  Campylobacter jejuni subsp. jejuni S3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cjs00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1642520..1643284)
Genome map
AA seq 254 aa AA seqDB search
MLNLDKFLEIAINASNQASKAILEERKNFKTWEKEDKSPITSADLASNKILNDILGSTDI
KILSEEKLLSKEECEELKTFWLIDPLDGTSGFLKGSDEFCVMISLVHDNRPVLSLIQNPS
KGDIFYAHAKTKVYKNDKPLQIDQQEYEKNKYKALLSVNHLSKEDEDFAKEHQLEAINIG
SGLKFCAILEARAGVYKRFEKLNIWDIVAGDFLINQNGGFMGDFSKKYILYNPLNYKSSP
FICVSSRNFLQDFL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcttgataaatttttagaaattgctataaatgctagcaatcaagcttctaaa
gctattttggaagagagaaaaaatttcaaaacttgggaaaaagaagataaaagcccgatt
acatcagcagatcttgcttctaataaaattctaaatgatattttgggttctacggatatt
aaaattctatcagaagaaaaattactcagcaaagaagagtgtgaagaattaaaaactttt
tggcttatcgatcctcttgatggaacaagtggttttttaaaaggcagtgatgaattttgc
gttatgataagtttggttcatgacaatcgccctgttttatcactcatacaaaatccatca
aaaggtgatatattctatgctcatgcaaaaaccaaggtttataaaaacgataaacctttg
caaattgaccagcaagaatacgagaaaaataaatataaagccttattgagtgttaatcat
cttagcaaagaagatgaagactttgcaaaagagcatcaattagaagctattaatataggc
tctggattgaaattttgtgctattttagaggctagggcaggagtttataaaagatttgaa
aagcttaatatttgggatattgtagcaggagattttttgattaatcaaaatggaggattt
atgggggatttttctaaaaaatacattttatataaccctttaaattataaatccagtcct
tttatttgtgtttcatctaggaattttttacaagattttttataa

DBGET integrated database retrieval system