KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0019Help
Entry
C8J_0019          CDS       T00597                                 

Definition
cytochrome C551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23689..24603)
Genome map
AA seq 304 aa AA seqDB search
MKKIIMILYLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMDKSLSKDGKVSCNTCH
RLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRAKDLAEQATVPFFNPKE
MGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAVAEFEKTLITPNSPFDHYLSGDQ
NAISAQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEYPNQEDLGRYEITKREADK
MVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKFLDQETVDNIVAFLESLTGE
YHDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatgattttatatttatcttatgcaaatatagtctttgcagtagat
atgataacccctattccaaattccatctcttatgataaagaaaaagctaaacttggaaaa
agtctttatatggataaaagtttatccaaagatggaaaagtttcgtgcaatacttgccat
aggcttgatcaacacggcgttgatggacttgaattttcaataggagttgataatcaactc
gataaaccctttaatactcctacaacctttaattctgtgtttaattttgtgcaattttgg
aatggcagagctaaagatttagcagaacaagctacagtaccttttttcaatcctaaagaa
atggggctaagtcctgaacttcttttacaaaaagttaattcaaatgaaaattatgtaaaa
acttttaaaaaactttatggagaagttacggtagaaaacatagcccttgcagttgctgaa
tttgaaaaaaccttgatcactccaaattctccttttgatcactatcttagcggggatcaa
aatgctatttcagctcaagctaaaaaaggttatgaagattttaaagccaatggctgtatc
tcttgccatcaaggtcaaaatataggtgggaatatgtttcaaaaaatcggtatttttgaa
gaatacccaaaccaagaagatttagggcgctatgaaatcacaaaaagagaagctgataaa
atggtatttaaagttcctagtcttagaaatatagccaaaaccgcaccttattttcatgat
ggatctatacctactttagatgcttgtgttcaatttatggcttactatcaactaggaaaa
tttttagatcaagaaacagttgacaatatagtcgcattcttagaaagcttaacaggagaa
tatcatgacaaataa

DBGET integrated database retrieval system