KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0183Help
Entry
C8J_0183          CDS       T00597                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cju00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192289..192861
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaaccatacttgaaattataggagaaaatcca
aatcgtgaaggactgattaaaacaccaaatcgtgtttttaaagcttatgaatttcttact
agtggttatacacaaaatgtcaaagaaattttaaatgacgctttatttgaaagctctaat
aatgaaatggttttagtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatattcctaataaaaaagtagtgggtttaagc
aaaattccacgccttgtagaggtgtttgcaagaagacttcaaattcaagaacaacttacc
gaacaaatcgcacaagctttaatggaaaatgtcgatgccaaaggtgttggcgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggagtacaaaaagctaattccaccactaca
acttcagctttgcgtggaattttcttaaaaaatgaaaaaactagagaagaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system