KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0183Help
Entry
C8J_0183          CDS       T00597                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00790  Folate biosynthesis
cju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C8J_0183 (folE)
Enzymes [BR:cju01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     C8J_0183 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF PHY
Motif
Other DBs
NCBI-ProteinID: ABV51782
UniProt: A8FJZ5
Position
192289..192861
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaaccatacttgaaattataggagaaaatcca
aatcgtgaaggactgattaaaacaccaaatcgtgtttttaaagcttatgaatttcttact
agtggttatacacaaaatgtcaaagaaattttaaatgacgctttatttgaaagctctaat
aatgaaatggttttagtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatattcctaataaaaaagtagtgggtttaagc
aaaattccacgccttgtagaggtgtttgcaagaagacttcaaattcaagaacaacttacc
gaacaaatcgcacaagctttaatggaaaatgtcgatgccaaaggtgttggcgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggagtacaaaaagctaattccaccactaca
acttcagctttgcgtggaattttcttaaaaaatgaaaaaactagagaagaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system