KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0325Help
Entry
C8J_0325          CDS       T00597                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00260  Glycine, serine and threonine metabolism
cju00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cju01100  Metabolic pathways
cju01110  Biosynthesis of secondary metabolites
cju01130  Biosynthesis of antibiotics
cju01230  Biosynthesis of amino acids
Module
cju_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C8J_0325 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C8J_0325 (trpB)
Enzymes [BR:cju01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     C8J_0325 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: ABV51924
UniProt: A8FKD7
Position
328878..330056
Genome map
AA seq 392 aa AA seqDB search
MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNELLKTYVGRPTPLYFAR
NLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAA
ALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKN
IFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLNKKVDYIIAAVGGGSNAAGIFYDF
IKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTKVLQDDLGNILPVHSVSAGL
DYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPT
LKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtattatggggattttggtgggcagtttttgcctgaaagtgcaatgttt
gctttaaatgagctagaaggtgcttttttgaaattttctaaagataaactctttaaaaaa
gaattaaacgagcttttaaaaacttatgtagggcgtcctactccactttattttgctaga
aatttaagcaaaaaatatcagcatgaaatttatttaaaacgcgaggatttaaatcatacc
ggagcacataaaatcaataatgccatcgctcaagcccttttagcaaaaaaaatgggaaag
aaaaaaatcatagcagaaacaggagcaggtcaacacgggcttgcaacagccactgcagca
gcacttttaggacttgaatgtgaaatttatatgggggcaaccgatgtgcaaagacaggct
ttaaatgtttataaaatggagcttttgggtgctaaaattcatgcagtacaaagtgggctt
aaaactctaaaagaagctactactgcggctattcaagcttgggttggagatattaaaaat
attttttatgtggttggaagtgcggtaggtccttatccttatcctaaaatggtaatgcat
tttcaaagtattataggaaaagaatgcaaaatgcaacttcaaaaactcaataaaaaagta
gattatattatcgcagctgttgggggtggaagcaatgcagctgggattttttatgatttt
atcaaagatgaaaatgttaaacttataggtattgaagcaggggggcttggcattgatacg
ccttatcatgcagcgactttaaataagggaaaaacaggcattattcacggtatgaaaacc
aaggttttacaagatgatttaggcaatatcttgcctgtacatagtgtttctgcagggctt
gattatccaggaattggtcctttgcatgcttttttatttgaaagcaaaagagcgcaatat
catgctataagtgatgaagaatgtatgcaggctttaaaattactttgtaaagaagaaggt
attattgcagcgattgaaagttcgcatgctttggcatttttagaaaaactttgtccaact
ttaaaaaagaaaagcgtgatagtagtaaatctttcaggcaggggagataaagatatgcaa
atgattagagattataaaaaaggggtgatttatggttga

DBGET integrated database retrieval system