KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0335Help
Entry
C8J_0335          CDS       T00597                                 

Definition
putative cytochrome C551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Brite
Enzymes [BR:cju01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     C8J_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336072..337097
Genome map
AA seq 341 aa AA seqDB search
MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKV
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaatcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttaccaaaagatcaaaaaggc
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagta
gagcttggcaaaaagctctattttgaaccacgtctttcaaaaagtggtatcatttcttgt
aatacctgtcataatgtaggacttggtggaacagatggaatcagtactgcaataggtcat
aaatggacagcaaatcctcatcatttaaattcaccaacagtttataatgcagttttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaacttgcagtagaaaaaatttcatctttg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagcggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaactttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagaacaaaaaggcttaaagcttttt
atagataaaggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggtgcgatttggaatttaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatctttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system