KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0805Help
Entry
C8J_0805          CDS       T00597                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C8J_0805 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C8J_0805 (murA)
Enzymes [BR:cju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     C8J_0805 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(809990..811246)
Genome map
AA seq 418 aa AA seqDB search
MTYLEIEGTNHLSGNVTISGAKNAALPLIVSSILAKNEVKINNVPNVADIKTLISLLENL
GAKVNFQNNSALLNTNTLNQTIAKYDIVRKMRASILTLGPLLARFGHCEVSLPGGCAIGQ
RPIDLHLLALEKMGANIQIKQGYVVASGNLKGNEILFDKITVTGSENIIMAAALAKGKTK
LLNVAKEPEVVQLCEVLKDAGLEIKGIGTDELEIYGTDGELLEFKEFSVIPDRIEAGTYL
CAGAITNSKITLDKVNATHLSAVLAKLHQMGFETLIAEDSITLLPAKEIKPVEIMTSEYP
GFPTDMQAQFMALALKANGTSIIDERLFENRFMHVSELLRMGADIKLNGHIATIVGGKEL
NAADVMATDLRASSALILAALAAKGTSKVHRIYHLDRGYENLEEKFKGLGAKITRLEE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacttatctagaaatcgaaggcacaaatcatctaagcggaaatgttacaataagcgga
gcaaaaaatgctgccctacccttgatcgtttcaagtatacttgctaaaaatgaagtaaaa
atcaacaatgttcctaatgttgctgatataaaaactcttatatctttgctagaaaattta
ggcgctaaggtcaattttcaaaacaatagtgctttattaaacacaaacactcttaatcaa
accatagccaagtatgacattgtgcgtaaaatgcgtgcttccatacttactctagggcct
ttacttgctcgttttgggcattgtgaagtatctttgcctggtggatgtgccataggacaa
agacctattgatttacatcttttagccttggaaaaaatgggggcaaatatacaaatcaaa
caaggctatgtcgtagctagtggaaatttaaaaggcaatgaaattctttttgataaaatc
acggttacaggtagtgaaaacatcatcatggcagcagctctagctaaaggtaaaaccaaa
ctcttaaatgttgcaaaagaacccgaagtagttcaactttgcgaagttttaaaagacgca
ggacttgaaattaaaggcataggtacagatgaacttgaaatttatggcactgatggagaa
cttttagaatttaaagaatttagcgttatacctgatagaattgaggcaggaacttatctt
tgtgctggggctattacaaattctaaaattactttagataaagttaatgccactcatctt
agtgcagttttagcaaaacttcatcaaatgggttttgaaactttgattgcagaagatagt
atcaccctacttcctgctaaagaaattaaacctgtagaaatcatgacaagtgaatatcca
ggctttccaaccgatatgcaagcgcagtttatggcattagccttaaaagctaatggaact
agtattatcgatgaaagactatttgaaaatcgtttcatgcatgtaagtgaacttttaaga
atgggtgcggatattaaactcaacggtcatattgctactatagtaggcggaaaagaactt
aacgctgctgatgtcatggctacagatttgcgtgcttcttcagcccttatcttagcagct
cttgcagctaaaggcacaagcaaagtccatagaatttatcatcttgataggggttatgaa
aatttagaagaaaaatttaaaggcttaggggctaaaatcacaaggcttgaagaatga

DBGET integrated database retrieval system