KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0835Help
Entry
C8J_0835          CDS       T00597                                 

Definition
HIT family protein
Orthology
K02503  
histidine triad (HIT) family protein
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Brite
Exosome [BR:cju04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   C8J_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846092..846457
Genome map
AA seq 121 aa AA seqDB search
MQEKTIFELIVEGKLPCNKVLESDDFLAFHDIAPKAPIHILIIPKKHFKDFQEFDPELMA
KMTSFIQELAVLLGVDKSGYRLVTNCGKNSGQEVFHLHFHMLGGFELPKEKTKKENPQAL
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaacaatttttgaactcatagttgaaggtaaacttccatgcaataaagtg
cttgaaagtgacgattttctagcatttcatgatattgcacccaaagcacccatacatata
cttataatccctaaaaaacactttaaagactttcaagaatttgatcctgaacttatggcc
aaaatgacaagtttcatacaagaattagctgttcttttaggcgtagataaaagtggatat
cgcttggtaacaaactgtggaaaaaatagtggacaagaagtttttcatttgcattttcat
atgcttggaggttttgaactacctaaggaaaaaacaaaaaaagaaaatcctcaagcttta
ttttaa

DBGET integrated database retrieval system