KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_0835Help
Entry
C8J_0835          CDS       T00597                                 

Definition
HIT family protein
Orthology
K02503  
histidine triad (HIT) family protein
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846092..846457
Genome map
AA seq 121 aa AA seqDB search
MQEKTIFELIVEGKLPCNKVLESDDFLAFHDIAPKAPIHILIIPKKHFKDFQEFDPELMA
KMTSFIQELAVLLGVDKSGYRLVTNCGKNSGQEVFHLHFHMLGGFELPKEKTKKENPQAL
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaacaatttttgaactcatagttgaaggtaaacttccatgcaataaagtg
cttgaaagtgacgattttctagcatttcatgatattgcacccaaagcacccatacatata
cttataatccctaaaaaacactttaaagactttcaagaatttgatcctgaacttatggcc
aaaatgacaagtttcatacaagaattagctgttcttttaggcgtagataaaagtggatat
cgcttggtaacaaactgtggaaaaaatagtggacaagaagtttttcatttgcattttcat
atgcttggaggttttgaactacctaaggaaaaaacaaaaaaagaaaatcctcaagcttta
ttttaa

DBGET integrated database retrieval system