KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1045Help
Entry
C8J_1045          CDS       T00597                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cju00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055305..1056072
Genome map
AA seq 255 aa AA seqDB search
MKAYAKANIFLKLTGFDSRKYHLLESRFILLKDLFDELELVDKESDSKKEFEIISNFKCE
NNIIQKAYLLLSKRYNNELKELFSKKSLKLTKNIPVCAGLGGGSSDCASFLLLMNETLNL
KLNLQELINLSIQLGSDIAFFLSGFHSANVSGCGEIIEEFEDDIPNLKWTFPQISCQTKA
VYDEFDRGIFDFQKNNNQAQIYKKLSTKELLQNFKNKELNDLFTPCATLYPKMKSYLQED
FFLSGSGSSVFKVDR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttacgctaaagcaaatatttttttaaaacttaccggttttgactcaagaaaa
tatcatcttttagaatcacgatttatacttttaaaagatctttttgatgagcttgagctt
gttgataaagaatcagactctaaaaaagaatttgaaatcattagtaattttaaatgcgaa
aataatattattcaaaaggcttacttactactttctaaaagatataacaacgaattaaaa
gaattatttagcaaaaaaagcctaaaactcacaaaaaatatcccagtatgtgctggactt
ggcggtggaagtagcgattgtgcgagttttttactactaatgaatgaaaccctaaattta
aaattaaacctacaagaacttataaatttaagcatacaactaggaagcgatattgccttt
tttttaagtggctttcactctgctaatgtaagtggctgtggcgaaattatagaagaattt
gaagatgacatacctaatttaaaatggacttttccacaaatatcttgccaaactaaagct
gtttatgatgaatttgatagaggaatatttgactttcaaaaaaacaataatcaagcgcaa
atctacaaaaaactcagcacaaaagagttgttacaaaattttaaaaacaaagaattaaat
gatttatttactccttgtgcaactttatatcctaaaatgaagtcttacttacaagaagat
ttttttctaagcggtagcggtagtagtgtttttaaggttgatcgatga

DBGET integrated database retrieval system