KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1121Help
Entry
C8J_1121          CDS       T00597                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00230  Purine metabolism
cju01100  Metabolic pathways
Module
cju_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    C8J_1121 (gmk)
Enzymes [BR:cju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     C8J_1121 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 ABC_tran RsgA_GTPase AAA_33 AAA_22 MMR_HSR1 Rad17 AAA_14 AAA_29 AAA_19 NTPase_1 KAP_NTPase RNA_helicase Thymidylate_kin AAA ATPase_2 NB-ARC AAA_17 NACHT CSF-1 DUF2075 cobW T2SSE RepB-RCR_reg AAA_30 Cytidylate_kin Adeno_IVa2 Zeta_toxin Viral_helicase1 AAA_28
Motif
Other DBs
NCBI-ProteinID: ABV52720
Position
complement(1124723..1125340)
Genome map
AA seq 205 aa AA seqDB search
MQGFILLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEF
QKGIDGDHFLEWAKVHENFYGTSLKHTQDALDNGKIVVFDIDVQGFKIARQKMADKIVSV
FITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSDYDYLIINDELKQSYEALRA
ILIAHKFRTKGQNLGQIQNIWNEGE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggttttattttgttgatttcaggtcctagtggagctggaaaatcaactctttta
aaaaaactttttgatgaatttgaagatgagctttatttttctatttcttcaacaactcgc
aaaccaagagagggtgaaaaaaatggaatacattatcatttcatatcccatgaagaattt
caaaaaggtatagatggtgatcattttttagaatgggctaaggtgcatgaaaatttttat
ggcacttctttaaagcacactcaagatgctttagataatggaaaaatagttgtttttgat
attgatgtgcaaggatttaaaatagccagacaaaaaatggctgataagattgtttctgtt
tttattactacaaaaaataaagatgagctaaaaaaaagacttattaagcgaaatactgat
acaataatacaactagaaaaaagattacaaaacgctagtgatgaaatgaaagaacttagc
gactatgattatcttatcattaatgatgagctaaagcaaagttatgaagcattgcgagcg
attttaattgcccataaatttagaaccaaagggcagaatctaggacaaattcaaaatatt
tggaatgaaggagaataa

DBGET integrated database retrieval system