KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1275Help
Entry
C8J_1275          CDS       T00597                                 

Gene name
nrfA
Definition
cytochrome c552 (EC:1.7.2.2)
Orthology
K03385  
nitrite reductase (cytochrome c-552) [EC:1.7.2.2]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:cju00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285959..1287791)
Genome map
AA seq 610 aa AA seqDB search
MKKNILRLGIVVLVLLIAGVLWLNNDINQKKEDEANKNAIAANADFSLLSDDDPNFEKWG
KVFPEQLKMYLTVEKEEPKATEFGGNLAYSKLIRFPQLTILWAGYPFSLDFNEERGHFWV
QIDQMKTARNNKDFLNAHGLAAFKGQPAACMNCHSGWTPWLIKNVAKGDFTAFNSTNYWT
MIKNIPAVDGIVENSPEHAGPHGGKRMGVTCADCHNPNDMSLRLTRPAAINALVSRGYEK
DPVQGVKATREEMRTLVCSQCHVEYYFKPTGEKVKVMGETIVDDSSKKWWNGTQKNYDEY
EFWRDGNKAKEIETDGIVLTFPWSEWKKGQPFRIEMLDDYYDKVRGVFGADFTHKLTGAQ
IIKIQHPESELYSGGVHAANGVSCVDCHMPYVREGAKKVTQHNITSPLRDINSACKSCHK
QSEDYLKAQVLDIQNSVAHDQRTAEYAIVSLIMDTKKLRDELGNMEKFQSDGKADTKKIS
EELKEVLELHRKAQMRADFVNAENSTGFHNPREASRMLLQAVDMARMGQTKLVEIAAANG
IKDFKTSNLGFEDIQKFNPGELYYKVDVNNHKAGERYYADEKDVNGNPPKELLEHDKELA
PYNYQVIDKK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatattttacgcttaggtattgtcgttttggttttacttatagcgggagtt
ttatggctaaataatgatatcaatcaaaaaaaagaagatgaagcaaataaaaatgccatt
gcagcaaatgctgatttttctttgcttagcgatgatgatccaaattttgaaaaatggggt
aaggtttttccagagcaactaaaaatgtatttaacggttgaaaaagaagagcctaaggct
actgaatttggtggtaatttagcttattcaaaattgattcgctttcctcaattaaccata
ctttgggcaggatatccttttagccttgatttcaatgaagaaagagggcatttttgggtt
caaatagatcaaatgaaaacagcaagaaacaacaaagattttcttaatgcccatggactt
gctgcttttaaaggtcaacccgcagcttgtatgaattgtcatagtggatggactccatgg
cttataaaaaatgttgctaaaggagattttactgcttttaactctacaaattattggact
atgattaaaaatatcccagctgttgatggtatagtagaaaattcacctgaacatgcaggc
ccacatggtggtaaaagaatgggtgtaacttgtgcagattgtcacaatccaaatgatatg
agtttaagacttactcgtccagcagctattaatgctttagtttctagaggatatgaaaaa
gatccagtacaaggcgtaaaagctacaagagaagaaatgagaactttagtttgctctcaa
tgccatgttgaatactattttaaaccaacaggggaaaaagtaaaagtaatgggtgaaact
attgtagatgatagttctaaaaaatggtggaatggaactcagaaaaattatgatgagtat
gaattttggagagatggcaataaagctaaagagattgaaaccgatggtatagttttaact
tttccttggagtgaatggaaaaaaggacaaccatttagaattgaaatgctagatgattat
tatgataaagttcgtggagtatttggagctgattttactcataaattaacaggagcgcaa
attattaaaattcaacatccagaaagtgaactttatagtggcggtgtgcatgctgcaaat
ggggtaagttgcgtggattgtcatatgccttatgttagagaaggagctaaaaaggttact
caacacaatatcacttctcctttaagagatattaactctgcttgtaagtcttgtcataaa
caaagcgaagattatttaaaagctcaagtgcttgacatacaaaatagcgttgcgcatgat
caaagaactgcagagtacgcaattgttagtttgattatggatactaaaaaactacgcgat
gagctaggtaatatggaaaaattccaaagcgatggaaaagctgatacgaaaaaaattagt
gaagagctaaaagaagttttagaacttcatcgtaaagctcaaatgagagcggattttgtt
aatgctgaaaactcaactggtttccataatcctcgcgaagcttcaagaatgttattgcaa
gctgttgatatggcaagaatgggacaaactaaacttgtagaaattgcagcggcaaatgga
attaaagattttaaaacttcaaatttaggttttgaagatattcaaaaatttaatccagga
gagctttattataaagtagatgttaataatcataaagctggagagcgttactatgcagat
gaaaaagatgttaatggcaatcctccaaaagaacttttagagcatgataaagagcttgct
ccttataattatcaagtgattgataaaaaataa

DBGET integrated database retrieval system