KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1298Help
Entry
C8J_1298          CDS       T00597                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315627..1316337
Genome map
AA seq 236 aa AA seqDB search
MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVE
LNGQKQENILFTKDSLITPDLIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMV
IALGDKNKPAIYVFSDPECPYCREHLAQIDDELKNYQVNYILTPVHGKSAFEKSALIYKE
AKKAKNDKEKIAILNKYYDANIKNYPKVSDTELKEVFSLYEKYRSLGLSATPTIIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaagtttaattcttgcctgttcagcatctttgtttgctgcaagtaattca
gaaattagtgatttttattcaaaaagcattaaagcacaatttccaaatgctaccgttagt
gtatcaaatcgtcaaaaggttggtaatacgggttttgaaagtgttattgtaagcgttgaa
ttaaatgggcaaaaacaagaaaacattctttttacaaaagatagtcttattacccctgat
cttatcgacttgaaaacgggaatttcttatgctcaagaatatgaaatgaaaaaatttcaa
gaagcaagagaaaattttacaaaaaatgctaaagctgtagcacaaaaagaaaccatggta
atagctttgggagataaaaataaacctgcgatttatgttttttcagatcctgaatgtcct
tattgtagagaacatttagctcaaattgatgatgaacttaaaaactatcaagttaattat
attttaactccagtacatggaaaatctgcttttgaaaaatccgctctaatctacaaagaa
gcaaaaaaagcaaaaaatgacaaagaaaaaatcgcaattttaaacaaatactatgatgca
aatatcaaaaattatccaaaagtaagcgatacagaattaaaagaagttttttccttatat
gaaaaatatcgctcattaggtcttagcgctactccaactattattaaataa

DBGET integrated database retrieval system