KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1298Help
Entry
C8J_1298          CDS       T00597                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Brite
Enzymes [BR:cju01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     C8J_1298
Secretion system [BR:cju02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   C8J_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315627..1316337
Genome map
AA seq 236 aa AA seqDB search
MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVE
LNGQKQENILFTKDSLITPDLIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMV
IALGDKNKPAIYVFSDPECPYCREHLAQIDDELKNYQVNYILTPVHGKSAFEKSALIYKE
AKKAKNDKEKIAILNKYYDANIKNYPKVSDTELKEVFSLYEKYRSLGLSATPTIIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaagtttaattcttgcctgttcagcatctttgtttgctgcaagtaattca
gaaattagtgatttttattcaaaaagcattaaagcacaatttccaaatgctaccgttagt
gtatcaaatcgtcaaaaggttggtaatacgggttttgaaagtgttattgtaagcgttgaa
ttaaatgggcaaaaacaagaaaacattctttttacaaaagatagtcttattacccctgat
cttatcgacttgaaaacgggaatttcttatgctcaagaatatgaaatgaaaaaatttcaa
gaagcaagagaaaattttacaaaaaatgctaaagctgtagcacaaaaagaaaccatggta
atagctttgggagataaaaataaacctgcgatttatgttttttcagatcctgaatgtcct
tattgtagagaacatttagctcaaattgatgatgaacttaaaaactatcaagttaattat
attttaactccagtacatggaaaatctgcttttgaaaaatccgctctaatctacaaagaa
gcaaaaaaagcaaaaaatgacaaagaaaaaatcgcaattttaaacaaatactatgatgca
aatatcaaaaattatccaaaagtaagcgatacagaattaaaagaagttttttccttatat
gaaaaatatcgctcattaggtcttagcgctactccaactattattaaataa

DBGET integrated database retrieval system