KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1332Help
Entry
C8J_1332          CDS       T00597                                 

Definition
hypothetical protein
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    C8J_1332
Enzymes [BR:cju01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     C8J_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1346540..1347325)
Genome map
AA seq 261 aa AA seqDB search
MNSNIVYIAMSADLIHPGHINIMKLAREYANKIEGKVVLGLLTDSAIASYKRLPYMNYEQ
RKIIVESIGFIDEVIPQNTLSYADNIIKLKPKFVIHGDDWKEGPQKRERSNVIALLKELG
CGELIEPKYTQGISSTELNQNAKSLGITTNARLSLLRRLINAKKPLRILETHSAISALIA
ENTFVSKNGTNLRRLINAKKPLRILETHSAISALIAENTFVSKNGTKIEFDGFWSSSLTD
STSRGKPDIEAVELSSRLKYG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaatatcgtatatatagctatgtctgctgatctgatacatcctggtcatata
aatattatgaaattagcaagagaatacgctaataaaattgaaggtaaggttgtattgggt
ttattgactgattctgcgattgcttcttataaacgacttccttatatgaattatgagcaa
agaaaaattattgttgaaagtataggttttattgatgaagtgatacctcaaaatactttg
agttatgctgataatattattaaactaaaacctaaatttgtgattcatggtgatgattgg
aaagaaggtcctcaaaaaagagaaagatcaaatgttattgctttgttgaaagaattaggt
tgtggagagctaatagagccaaaatatacccaaggtatcagttctactgaacttaatcaa
aatgcaaaatctctaggtattacaactaatgctagattatcacttttaaggcgtttaatt
aatgctaaaaaacctttaagaattttagaaacgcattctgcaatttcagcattgattgca
gaaaacacttttgttagtaaaaatggtacaaatttaaggcgtttaattaatgctaaaaaa
cctttaagaattttagaaacgcattctgcaatttcagcattgattgcagaaaacactttt
gttagtaaaaatggtacaaaaatagaatttgacggtttttggtctagttctttaactgat
tcaacaagtagaggaaagcctgatattgaagcggtagaattatcaagtaggcttaaatac
ggttaa

DBGET integrated database retrieval system