KEGG   Campylobacter jejuni subsp. jejuni 81116: C8J_1436Help
Entry
C8J_1436          CDS       T00597                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cju  Campylobacter jejuni subsp. jejuni 81116
Pathway
cju00010  Glycolysis / Gluconeogenesis
cju00620  Pyruvate metabolism
cju00640  Propanoate metabolism
cju00680  Methane metabolism
cju01100  Metabolic pathways
cju01110  Biosynthesis of secondary metabolites
cju01120  Microbial metabolism in diverse environments
cju01130  Biosynthesis of antibiotics
cju01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cju00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C8J_1436 (acs)
   00620 Pyruvate metabolism
    C8J_1436 (acs)
   00640 Propanoate metabolism
    C8J_1436 (acs)
  Energy metabolism
   00680 Methane metabolism
    C8J_1436 (acs)
Enzymes [BR:cju01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     C8J_1436 (acs)
Lipid biosynthesis proteins [BR:cju01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   C8J_1436 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABV53034
UniProt: A8FNJ7
Position
complement(1455259..1457232)
Genome map
AA seq 657 aa AA seqDB search
MLNQNNQELFKPSKEFSRNARIKNLCEYYDLCDEAKEDFEGFWKRQALEKIEWFSPFSRV
LNEDKAPFYKWFEGGTLNVSYQCLDRHMKTRRNKAALIFEGEMGDYEVYTYRRLLHETCK
AANLLKKFGVKKGDRVVIYMPMIPETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAG
AKLVVTADGAFRRGKPYMLKPAVDKALSEGCESVEKVLIVIRNNEPIEYIKGRDYVYNEL
VKNESYKCEPEIMDSEDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWVFDIKDYDN
YWCSADVGWITGHTYVVYGPLACGATTIMHEGTPTYPNSGRWWRMIEEYQISKFYTSPTA
IRMLHADAPDEPRKYDLSTLEVLGTVGEPINPSAWKWFYDEIGGTKSPIVDTWWQTETGG
HMITPLPGATPLKPGCATLPLPGIFAEVIDEEGNKKDEGEDGLLCITKPWPSMIRGIWGN
DERYIESYFSQAKKDGKAVYFSGDGAFYDKNGYITITGRTDDVVNVAGHRIGTAEIESAI
AKHPSVAESAVVSILDAIKGESLFAFVVLSPASSCDLGGAIETLKELNDILRVEIGPIAK
IEKILYTPGLPKTRSGKIMRRILRTIARGEEIKQDISTLEDSGVVETIVKLAKAEFE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaaaataatcaagagctttttaagccaagtaaagaattttctcgtaatgct
cgtataaaaaatttatgtgaatactatgatttatgcgatgaagccaaggaagattttgaa
ggtttttggaaaagacaagcacttgagaagatcgagtggttttcgcctttttcaagagtg
ttaaatgaggataaagctccattttataaatggtttgaaggtggaactttaaatgtaagt
tatcaatgtcttgatcgtcatatgaaaacaagacgcaataaagctgctttgatttttgaa
ggtgaaatgggggattatgaagtttatacttatagaagattattgcatgaaacttgcaag
gcggccaatttgcttaaaaaattcggagtaaaaaaaggcgatagggttgtaatttatatg
cctatgattccagaaacagctatagtaatgttagcttgtgcaaggattggggctattcat
agtgtggtatttggagggttttctcctgaagccttaagagatagaattatagatgcagga
gctaaacttgtagtaacggctgatggtgcttttcgtcgtggcaaaccttatatgttaaaa
cctgcagtagataaggctttaagtgaagggtgtgaaagtgtagaaaaagtacttatagtt
atacgcaataatgagcctatagaatatattaaaggaagggactatgtttataacgaactt
gtgaaaaatgagtcttataagtgtgaacccgaaatcatggatagcgaggatttgttgttt
ttgctttacacttcaggatcaacgggcaagccaaaaggagttatgcatgcaagtgcagga
tatatactttgggcacaaatgactatggaatgggtttttgatattaaagattatgataat
tattggtgtagtgctgatgtgggttggattacaggacatacttatgtagtttatgggcct
ttagcatgtggagcaacgactataatgcatgaaggaactcctacttatccaaattctggg
cgttggtggagaatgatagaagagtatcaaataagcaaattctacacttcgccaactgcc
ataagaatgcttcatgctgatgcacctgatgagccaagaaaatatgatttaagtacgctt
gaagtgcttggaacggttggagagcctatcaatcctagtgcttggaagtggttttatgat
gaaatagggggaactaaaagtcctatagtcgatacttggtggcaaacagaaacaggtggg
catatgatcacgcctttaccaggcgctactcctttaaaaccaggttgtgctaccttgcct
ttgccaggaatttttgcagaagttattgatgaagaaggcaataaaaaagatgaaggtgaa
gatggattgctttgtataaccaaaccttggccttcgatgattcgtggaatttggggtaat
gatgaacgctatatagaaagttatttttctcaagctaaaaaagatggaaaagctgtatat
tttagtggcgatggtgctttttatgataaaaatggttatataactatcacaggaagaaca
gatgatgtggttaatgttgcaggacatcgtataggaacggctgaaattgaaagcgctatt
gctaaacatccaagtgtagcagaatcagctgtagtgagtattttggatgcgattaagggc
gagtcactgtttgcttttgtggttttaagtcctgcatccagttgtgatcttggcggagct
atagaaactttaaaagaacttaatgacattttaagagtagaaataggacctatagctaaa
atagaaaaaattctttatactccaggtttgccaaaaactagaagtggtaaaataatgaga
agaattttaagaactatagcaagaggtgaagaaatcaaacaggatatttcaacgctcgaa
gattctggagtagtagaaactattgttaaattagctaaggcagagtttgaataa

DBGET integrated database retrieval system