KEGG   Campylobacter jejuni 32488: M635_02595Help
Entry
M635_02595        CDS       T02759                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cjz  Campylobacter jejuni 32488
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
506354..507064
Genome map
AA seq 236 aa AA seqDB search
MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVE
LNGQKQENILFTKDSLITPDLIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMV
IALGDKNKPAIYVFSDPECPYCREHLAQIDDELKNYQVNYILTPVHGKSAFEKSALIYKE
AKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaagtttaattcttgcctgttcagcatctttgtttgctgcaagtaattca
gaaattagtgatttttattcaaaaagcattaaagcacaatttccaaatgctaccgttagt
gtatcaaatcgtcaaaaggttggtaatacgggttttgaaagtgttattgtaagcgttgaa
ttaaatggacaaaaacaagaaaacattctttttacaaaagatagtcttattacccctgat
cttatcgacttgaaaacgggaatttcttatgctcaagaatatgaaatgaaaaaatttcaa
gaagcaagagaaaattttacaaaaaatgctaaagctgtagcacaaaaagaaaccatggta
atagctttgggagataaaaataaacctgcaatttatgttttttcagatcctgaatgccct
tattgtagagaacatttagctcaaattgatgatgaacttaaaaactatcaagttaattat
attttaactccagtacatggaaaatctgcttttgaaaaatccgctctaatctacaaggaa
gcaaaaaaagcaaaaaatgataaagaaaaaatcgcaattttaaacaaatactatgatgca
aatatcaaaaattatccaaaagtaagtgatgcagaattaaaagaagttttttccttatat
gaaaaatatcgctcattaggtcttagcgctactccaactattattaaataa

DBGET integrated database retrieval system