KEGG   Campylobacter jejuni 32488: M635_02620Help
Entry
M635_02620        CDS       T02759                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
cjz  Campylobacter jejuni 32488
Pathway
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjz00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M635_02620
  Amino acid metabolism
   00380 Tryptophan metabolism
    M635_02620
Enzymes [BR:cjz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     M635_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
509318..510742
Genome map
AA seq 474 aa AA seqDB search
MKKLTNDFGNIIADNQNSLSAGAKGPLLMQDYLLLEKLAHQNRERIPERTVHAKGSGAYG
EIKITADLSAYTKAKIFQKGEITPLFLRFSTVAGEAGAADAERDVRGFAIKFYTKEGNWD
LVGNNTPTFFIRDAYKFPDFIHTQKRDPRTHLRSNNAAWDFWSLCPESLHQVTILMSDRG
IPASYRHMHGFGSHTYSFINDKNERFWVKFHFKTQQGIKNLTNQEAAELIAKDRESHQRD
LYNAIENKDFPKWKVQVQILAEKDIEKLGFNPFDLTKIWPHSFVPLMDIGEMILNKNPQN
YFNEVEQAAFSPSNIVPGIGFSPDKMLQARIFSYPDAQRYRIGTNYHLLPVNRAKSEVNT
YNVAGAMNFDSYKNDAAYYEPNSYDNSPKEDKSYLEPDLVLEGVAQRYAPLDNDFYTQPR
ALFNLMNDDQKTQLFHNIAASMEGVDEKIITRALKHFEKISPDYAKGIKKALEK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaactaacgattttggaaacattatagccgataaccaaaattcattaagt
gcaggcgcaaaaggacctttgcttatgcaagattatcttttgcttgaaaaacttgctcat
caaaatagagaaagaattccagaaagaaccgttcatgccaagggaagtggggcttatgga
gaaataaaaatcaccgctgatttatctgcttatactaaggcaaaaatatttcaaaaagga
gaaataactcctcttttcctacgcttttctactgttgcaggtgaagcaggtgcagcagat
gctgagcgtgatgtacgtggatttgccattaaattttacaccaaagaaggaaactgggat
ttagtaggaaataatactccaactttttttatccgtgatgcgtataaatttcctgatttc
attcatactcaaaaaagagatccaagaactcatctaagaagtaataatgctgcttgggat
ttttggagtttatgtcctgaaagtttacatcaagtaaccattcttatgagcgatagagga
attcctgcaagttatcgtcatatgcatggatttggaagccatacttatagttttattaat
gataaaaatgaaagattttgggtgaaattccattttaaaacccaacaagggattaaaaat
cttaccaaccaagaagctgccgagcttatagcaaaagatagagaaagtcatcaaagagat
ctctataatgctatagaaaataaagattttccaaaatggaaagttcaagttcaaattctt
gctgaaaaagatatagaaaaacttggatttaatccttttgatttaacaaaaatttggcct
catagttttgtacctttgatggatataggcgaaatgattctaaacaaaaatcctcaaaat
tattttaatgaagttgaacaagctgcctttagtccaagcaatatcgttcctggaattggc
tttagccctgataaaatgttgcaagctagaattttttcatatcctgatgcacaaagatat
agaataggaactaattatcatcttttaccagtaaatcgtgcaaaaagcgaagtgaatact
tacaatgtcgctggtgctatgaattttgatagttataaaaatgatgctgcttattatgaa
ccaaacagctatgataatagcccaaaagaagacaaaagctatcttgaacctgatttagtc
ttagaaggcgtagcacaaagatatgctccactagataatgacttttatactcaaccaaga
gctttatttaatcttatgaatgatgatcaaaaaactcaactttttcataatatcgccgct
tctatggaaggagttgatgaaaaaattatcactagagctttaaaacattttgaaaaaatt
tcacctgattatgcaaaaggaattaaaaaagctttagaaaaataa

DBGET integrated database retrieval system