KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0187Help
Entry
Calkr_0187        CDS       T01356                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cki00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
225458..226585
Genome map
AA seq 375 aa AA seqDB search
MRLISKDANIKRILYQKGFDEKDILEFEKEANSIILRFDDVKNPSRFVQLLSNLGYFTIS
NGSMCFATTSLNSLEKTRCVLAEEGIQCSFDVDLTISQRYLLAKDKKLSLLKTNVMGIIN
VTPDSFYEGSRVQVEKVTQRALQMIQDGADVLDIGGESTRPFSEPVSEEEELKRVIPAIE
AIREVDKNIPISIDTYKSKVAQKAIEAGADIINDISGGTFDKEMFYVAAHYNVPIVIMHI
KGTPKDMQKNPYYEDVIEEILQFFEQRIEQALKAGVKLENIILDPGIGFGKRLEDNLEIL
RRCEEFKVLGRPILIGASRKSVIGHVLGNLPPEERLEGTLAISVICAQKKIEFVRVHDVK
ENKRAILMTQAIFQS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgaggctgatatcaaaagatgcgaatataaaaaggattttgtatcaaaaaggttttgat
gagaaagacattttggagtttgaaaaagaagcaaactcgataattttaaggtttgatgat
gtaaaaaatccatcaaggtttgtccagcttctttcaaacctcggttattttacaatctca
aatggcagtatgtgctttgcaacaacatcactcaatagcttggaaaagacaagatgtgtc
cttgctgaggaaggaatacagtgcagctttgatgtagaccttaccatttcgcaaagatac
ttgctggcaaaagataaaaaattaagccttttgaagacaaacgtgatggggattataaat
gtcacaccagactcgttttatgagggctcaagagttcaagttgaaaaggtaacccaaaga
gcacttcagatgattcaagatggtgcagatgttctggacattggcggtgagtcgacaaga
cctttttcagagccagtgtcggaagaggaggagctaaaaagagtaattcctgcaattgaa
gcgataagggaagtggataagaacattccaatttcgattgatacatacaaaagcaaggtg
gctcaaaaagcaatagaggccggtgctgacattataaatgatatcagcggtgggacgttt
gacaaagagatgttttatgttgcagcgcactacaatgttcctatcgtaatcatgcacatc
aaaggcacgccaaaggatatgcagaaaaatccttactatgaagatgttatagaagagatt
ttgcagttttttgaacaaaggattgaacaggcactgaaagctggcgtgaagcttgaaaac
atcattttggaccctggcattggttttgggaaaaggcttgaagacaacttagagatactg
cgaaggtgcgaagagttcaaggttttaggaagacccattttgattggggcatccagaaaa
tcggtgattggccatgtgctcggcaatcttccacctgaggaaaggcttgaaggtactttg
gcaatctctgtgatatgtgctcagaaaaagattgaatttgtaagggtgcatgatgtgaaa
gaaaacaaaagagccatcttgatgacacaggcaatcttccagtcttaa

DBGET integrated database retrieval system