KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0613Help
Entry
Calkr_0613        CDS       T01356                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00260  Glycine, serine and threonine metabolism
cki00750  Vitamin B6 metabolism
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01120  Microbial metabolism in diverse environments
cki01230  Biosynthesis of amino acids
Module
cki_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkr_0613
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calkr_0613
Enzymes [BR:cki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calkr_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Baculo_LEF-11
Motif
Other DBs
NCBI-ProteinID: ADQ40158
UniProt: E4SA81
Position
662281..663762
Genome map
AA seq 493 aa AA seqDB search
MRYISTRGSKEVQAKEAIYRGIAEDGGLYTPVSIPSLDIGEIKNIDSYANLAKYIFELYL
TDFTKEEIADCIDRAYSRGRFDTKDIVGIKKLSPGLFALELWHGPTYAFKDVALQVLPHL
LLKSMPSFYKQALILVATSGDTGKAALEGFKDVERTKIVVFYPSEGVSDVQKRQMTTQEG
RNTFVAGIKGNFDDAQSGVKEIFTSKKCIDTIENLGFFFTSANSINFGRLLPQIVYYIWS
YLVLLKAGDISEDEKINFVVPTGNFGNILAGFIAKLMGIPINKLIVASNINSVVADFVRT
GLYDRRRKFYKTISPSMDILVASNLERLLYLVTRDSERVKRYMLDLKTEGYFKVEEEVLK
EIQESFWGDFSTDDQTRNSIKTIYREYGYLVDPHSAVGFDVYTKYQKQTSDNTKTVVLQT
ANPYKFAKDVLNALFDGEYNNIDPFEALEILYAKTGVEVPEGIKSLLSKPILHPDVIEKD
KMFDFILEKIRDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatataagcacaagagggagcaaagaggtgcaggcaaaagaagctatttacagg
ggaatagctgaagatggtgggctttacacacctgtttcaattccatctcttgacatagga
gagataaaaaacatagactcttacgcaaatcttgcaaaatatatatttgagctttacctt
acagattttacaaaagaagagattgctgattgcattgacagggcatatagccgtggcagg
tttgacacaaaagatattgtgggtatcaaaaagctcagtcctggtctttttgcacttgag
ctgtggcacggtccgacgtacgcttttaaagacgttgcgttgcaggttctgcctcatctt
ttgttaaaatcaatgccgagtttttacaaacaggcgctaatacttgttgcaacatcaggc
gatactggcaaagctgccttggaagggtttaaggatgtggagagaacaaagatagttgtg
ttttatccatctgagggtgtgtcagatgttcagaaaagacagatgacaacccaggaaggc
agaaacacttttgttgccgggataaaaggcaattttgatgatgcccaatctggtgtgaag
gagattttcacaagcaaaaaatgcatagatacaatcgaaaatctggggtttttctttacc
tccgcaaactcaataaattttggtaggcttcttccacagattgtatactatatctggagt
tatctggtgcttttaaaggctggagatatatctgaagatgaaaagataaactttgttgtt
ccgacgggcaattttggcaatatattggcaggttttatcgcaaaacttatgggaattcct
ataaataagctgattgttgcttcgaacataaacagtgtggttgcagattttgtcaggaca
ggcttatatgacagaagaagaaagttttacaaaacaatctcaccttcaatggatattctt
gttgcaagtaatttggaaaggttattgtatttggtaacaagagattcagaaagagtaaaa
agatacatgttagatttgaaaactgaggggtatttcaaagttgaggaagaagttttaaaa
gagattcaggaaagtttctggggcgatttttccacagatgaccagacaagaaatagcata
aaaactatttaccgcgaatatggttatcttgttgacccgcactctgctgttgggtttgat
gtttacaccaagtaccaaaagcagacctctgataacacaaaaacggttgtacttcagact
gcaaatccttacaagtttgcaaaagatgttttgaacgctttgtttgatggtgaatataat
aatattgacccgtttgaagcactagagattttgtatgcaaagacaggtgttgaggtcccg
gaggggattaaaagtcttctttcaaagccaattttgcatcctgatgtgatagaaaaagac
aagatgtttgattttatattagagaaaataagagataattaa

DBGET integrated database retrieval system