KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0644Help
Entry
Calkr_0644        CDS       T01356                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00010  Glycolysis / Gluconeogenesis
cki00020  Citrate cycle (TCA cycle)
cki00620  Pyruvate metabolism
cki00633  Nitrotoluene degradation
cki00640  Propanoate metabolism
cki00650  Butanoate metabolism
cki00680  Methane metabolism
cki01100  Metabolic pathways
cki01120  Microbial metabolism in diverse environments
cki01130  Biosynthesis of antibiotics
cki01200  Carbon metabolism
Module
cki_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_0644
   00020 Citrate cycle (TCA cycle)
    Calkr_0644
   00620 Pyruvate metabolism
    Calkr_0644
   00640 Propanoate metabolism
    Calkr_0644
   00650 Butanoate metabolism
    Calkr_0644
  Energy metabolism
   00680 Methane metabolism
    Calkr_0644
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calkr_0644
Enzymes [BR:cki01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calkr_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADQ40184
UniProt: E4SAA7
Position
699463..700644
Genome map
AA seq 393 aa AA seqDB search
MAIRDRLSGNEAIAFAMKQINPDVVAAFPITPSTEVPQYFSQYVANGEVDTEFVAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDELVKKFVGEYNPEFYLLNEQNPISMGPLDLPPYYFEHKRQQAEAMRNAKKVVLEIA
EEFAALTGRKYGLFEAYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVDEIVGALKHLKAVAIMDKSDGFNAAGGPLFTEITSALYGRADGIKAINYIYGLGGRD
VKTDDIAKVYDRLLDIVKTGNVGEVYNYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctattcgtgatagactttctggtaacgaagcgatagcttttgcaatgaaacagata
aaccctgatgttgttgccgctttcccaattacaccttcaactgaggtgccacaatatttt
tctcaatatgttgcaaacggtgaggtagacactgagtttgttgctgttgagtctgagcac
agcgcaatgagcgcatgtattggtgcatcagctgcgggagctcgaactatgacagcaaca
tcctcacaaggtttggcactcatgtgggagatgctctacattgcagcgtcaatgagactt
ccaattgttatggcagttataaacagagctctttctggtcctattaatattcacaacgac
cattcagactcaatgggtgcaagagacagtggctggattcagatttactgcgaaaacaac
caggaagcttacgactctttgattcaggcaataagaattgctgagcacaaggatgtaaga
cttcctgtgatggtgtgctatgacggattcatcacaagccatgctgttgagaatatagag
cttttggaagatgaacttgtaaagaagtttgtaggtgaatacaatccagagttttatctt
ttgaacgagcaaaacccaatttcaatgggtccgttagatttgccaccgtactactttgag
cacaaaagacagcaggctgaagctatgagaaacgctaaaaaggtagtacttgagattgca
gaagagtttgctgctttgactggcagaaagtatggtctttttgaggcatacaagcttgac
gatgcagaggttgcaatagttgtaatgaactcaacagcaggaactgcaaaggctgttgtt
gacgagtacagaagcaaaggatacaaggtaggtcttttaaagccaagacttttcagacca
tttcctgttgatgagattgtaggggcactcaagcacttaaaagcagttgctataatggac
aagtcagatggatttaacgcagctggcggtccacttttcactgagattacaagtgctctt
tatgggagagcagatggtataaaggctattaactacatctatggtcttggcggaagagat
gtcaagacagatgacatcgcaaaggtttatgacagacttcttgacattgtcaagacagga
aatgttggtgaagtttacaactacattggtgtgagagaataa

DBGET integrated database retrieval system