KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0773Help
Entry
Calkr_0773        CDS       T01356                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calkr_0773
Enzymes [BR:cki01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Calkr_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838076..840115
Genome map
AA seq 679 aa AA seqDB search
MGKIKLKKFLHGGDYNPDQWTEDVWEKDIEFMKYYNVNAVSMPIFSWAQLQPNEDEFTFE
WLDKIINKLYSNGIHVILATPTASQPAWLSKKYPDVLPVDIHGRKRKHGARQNYCPNSPN
FKNAARRIVEEMAKRYKDHPAVIMWHISNEYGPYCYCENCAKAFREWLKERYKTLDELNR
RWNTAFWGHTFYDWDEIEVPSYLNEEFEYMHGRQKSSFQGLSLDYKRFMSDSLLNLYKME
VEIIKKYMPDIPVTTNLMGPFKPLDYHKWAKDMDIVSWDNYPSIKDTPSSTAFKHDLMRG
LKRDQSFILMEQTPSQTNWHWYNSAKRPGMIRLLSYHAIAHGADSVLYFQWRQSVASCEK
FHSAMVSHVGHLETRVSKELKKIGDELLRLDEILESTTKSEVALLFDWENWWALEESMGF
RNDISYLEHIDAYYKALYKLKTNVDVVDPKEDLTRYKLVVAPLLYLLDQESVNNIENYVK
NGGIFITTYLSGLVDENDRVILGGYPGWFRKLCGIWVEEIDALFPDMKNAIILEKPIGML
DGKYECDFICDVIHLEGARALAYYERDYYSGMPAVVENDYGNGKAIYIGTRPEQRFIEGL
VKYYAEKAGVQPILPVPEGVEITKREKNGNEYVFLLNFNNYDVNIELEDEYYELITQKVL
SGKATLASKEVMVLRKLKG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaagctaaaaaaatttttgcacggtggagactacaatcctgaccagtgg
acagaggatgtgtgggaaaaagacattgaatttatgaaatactataatgtgaatgcagtt
tctatgccaatattttcatgggcacagcttcagccaaatgaagatgaatttacatttgaa
tggcttgataaaataatcaataagctctattcaaatggaattcatgtcatcttggcaaca
cctacagcttctcagccagcatggctctctaaaaagtatcctgatgtgcttcctgttgat
attcatggaagaaagagaaaacatggagcaaggcagaactactgtcctaacagtccaaac
ttcaaaaatgcagcaagaagaattgttgaggagatggcaaaaaggtataaagaccatcct
gcagttataatgtggcatatcagtaacgaatatggtccttactgctactgtgaaaactgt
gcaaaagcctttagagagtggctaaaagaaagatataaaacattggatgagctcaacaga
agatggaacacagctttctggggacatacattttatgattgggatgagatagaagttcca
tcgtatctgaacgaagagtttgaatatatgcatggaaggcagaagagttcattccaggga
ctttcgcttgattacaaaaggtttatgtcagatagccttctaaatctttataaaatggaa
gttgagattatcaaaaaatacatgccagatatccctgttacaacaaacttgatgggacca
ttcaagcctcttgactatcacaaatgggcaaaagatatggacattgtatcatgggacaat
tatccttcgataaaagatactccaagttctactgccttcaaacatgaccttatgagagga
ctcaaaagagaccagtctttcatattaatggaacagacaccaagccagacaaactggcac
tggtacaactctgcaaaaagacctggtatgataaggcttttgagctatcacgcaattgca
cacggagctgattctgtactgtatttccagtggagacagtctgttgcttcgtgtgaaaag
tttcactctgcaatggtttcgcatgttggacaccttgagacgagagtgagcaaggagctt
aaaaagattggcgacgaacttttgcgcttggatgagattttggagtcaacaacaaagagc
gaggttgcactattatttgactgggaaaactggtgggcgcttgaagagagcatgggattt
agaaatgatatatcttaccttgaacatatagatgcttactataaagcgctgtataaacta
aaaacaaatgtggatgttgttgacccgaaagaggatttaacaaggtacaagcttgttgtt
gcaccacttttgtatcttctcgaccaagagagtgtaaataacatagaaaattatgtaaaa
aacggtggaatatttattacaacatatttatcaggtcttgtagatgaaaatgacagagta
attcttggtggctatccgggttggttcaggaagctttgtggtatatgggttgaggagatt
gatgcgctttttcctgatatgaaaaatgcaattatacttgaaaaacctattggcatgctt
gatggcaaatacgaatgtgattttatctgtgacgttattcaccttgaaggtgcaagggcg
cttgcttactatgaacgggattattacagcgggatgccagcagttgttgaaaatgattat
ggaaatggaaaggcaatttatattggaacaagaccagagcaaaggtttatagaaggcctt
gttaagtactacgctgaaaaggctggtgtacaaccaatattacctgtaccagaaggtgtt
gaaataacaaaaagagaaaagaatggtaatgaatatgtgtttcttttgaatttcaataat
tatgatgtaaatattgagcttgaagatgagtattatgagcttataacacagaaggtttta
agcggaaaagctactcttgcatccaaagaggttatggtactaagaaagttgaaaggttaa

DBGET integrated database retrieval system