KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0849Help
Entry
Calkr_0849        CDS       T01356                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calkr_0849
   01230 Biosynthesis of amino acids
    Calkr_0849
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_0849
   00030 Pentose phosphate pathway
    Calkr_0849
   00051 Fructose and mannose metabolism
    Calkr_0849
   00052 Galactose metabolism
    Calkr_0849
  Energy metabolism
   00680 Methane metabolism
    Calkr_0849
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Calkr_0849
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calkr_0849
Protein phosphatases and associated proteins [BR:cki01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calkr_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(917216..918463)
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVVAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYIKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAQKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALASKDIGAPDLIYLPEVPFSIDKFLDDVRNIHKKTGKITI
VVSEGIKDKEGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKSIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVRYAVEGACGYMVAIKRDSDNPYSSSTELVELSKVANAE
KLVPLAWISHDGNYVKEDALNYIQPLIEGEVEVKYERGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaaggtaactgcgtggttgcgcaatcaggtggaccaactgctgtcatcaac
gcatcgcttctgggtgttattgaagaagctatgaaacagcacccaatccgtgctatttat
ggtgctaaaaatggaatcattggtcttattgacgaagagctttacgacctcagaatggaa
gaccctgaagagctaaaacttttaaagacaactccatcatctgctttaggttcttgcagg
tatcagctcaagccttttgaacatgatgaaaaagactatatcaagattttcaatgtattt
gaggcgcacaacatccgctactttttctatataggcggaaacgactcaatggacacagct
gacaagctcacacgatatgcgcaaaaaattgggtatgacatatgcataatcggaattcca
aagacaatcgacaacgaccttgtgatgacagaccactgtccgggttttggaagtgctgca
aagtacattgcaacatctgtgatggaaattgcaagagatgcagtggtgtacccaacaaac
attgttactataattgaagtgatgggaagaaacgctggctggcttgcagcagcatctgca
ctggcatctaaagatataggcgcaccagatttaatataccttcctgaagttccattttca
atcgacaagtttttggatgatgtaagaaacatccacaaaaaaactggaaagatcactatt
gtggtttcagagggtataaaagacaaagaaggaaagtatattgctgatatgagccacaag
tttggaatagacgcgtttgggcatgtgcagcttggcggtgcagcatttgttttagagaac
atcatccgcgaagaagtggaaaagagagtaaaatcaattcaattcaacgtactgcagcgc
agtgctgctcatatcatgtccaaaactgacgttgaggaagcgtacatggttggacgcatg
gcagtaaggtacgcggttgaaggcgcttgtggatacatggtagcaataaaacgcgacagt
gacaatccttattcaagttcaacagagcttgttgagctcagcaaggttgcaaatgctgaa
aagcttgtcccgcttgcatggatatcacatgacggcaactatgtaaaagaagatgctcta
aattatatccagccgctaattgaaggtgaagttgaagtcaagtacgaaagaggtcttcct
cgatatgcaaagctcagaaagataatggtgccaaagaaggtcgtataa

DBGET integrated database retrieval system