KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0849Help
Entry
Calkr_0849        CDS       T01356                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00010  Glycolysis / Gluconeogenesis
cki00030  Pentose phosphate pathway
cki00051  Fructose and mannose metabolism
cki00052  Galactose metabolism
cki00680  Methane metabolism
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01120  Microbial metabolism in diverse environments
cki01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_0849
   00030 Pentose phosphate pathway
    Calkr_0849
   00051 Fructose and mannose metabolism
    Calkr_0849
   00052 Galactose metabolism
    Calkr_0849
  Energy metabolism
   00680 Methane metabolism
    Calkr_0849
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calkr_0849
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Calkr_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADQ40372
UniProt: E4S4D5
Position
complement(917216..918463)
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVVAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYIKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAQKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALASKDIGAPDLIYLPEVPFSIDKFLDDVRNIHKKTGKITI
VVSEGIKDKEGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKSIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVRYAVEGACGYMVAIKRDSDNPYSSSTELVELSKVANAE
KLVPLAWISHDGNYVKEDALNYIQPLIEGEVEVKYERGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaaggtaactgcgtggttgcgcaatcaggtggaccaactgctgtcatcaac
gcatcgcttctgggtgttattgaagaagctatgaaacagcacccaatccgtgctatttat
ggtgctaaaaatggaatcattggtcttattgacgaagagctttacgacctcagaatggaa
gaccctgaagagctaaaacttttaaagacaactccatcatctgctttaggttcttgcagg
tatcagctcaagccttttgaacatgatgaaaaagactatatcaagattttcaatgtattt
gaggcgcacaacatccgctactttttctatataggcggaaacgactcaatggacacagct
gacaagctcacacgatatgcgcaaaaaattgggtatgacatatgcataatcggaattcca
aagacaatcgacaacgaccttgtgatgacagaccactgtccgggttttggaagtgctgca
aagtacattgcaacatctgtgatggaaattgcaagagatgcagtggtgtacccaacaaac
attgttactataattgaagtgatgggaagaaacgctggctggcttgcagcagcatctgca
ctggcatctaaagatataggcgcaccagatttaatataccttcctgaagttccattttca
atcgacaagtttttggatgatgtaagaaacatccacaaaaaaactggaaagatcactatt
gtggtttcagagggtataaaagacaaagaaggaaagtatattgctgatatgagccacaag
tttggaatagacgcgtttgggcatgtgcagcttggcggtgcagcatttgttttagagaac
atcatccgcgaagaagtggaaaagagagtaaaatcaattcaattcaacgtactgcagcgc
agtgctgctcatatcatgtccaaaactgacgttgaggaagcgtacatggttggacgcatg
gcagtaaggtacgcggttgaaggcgcttgtggatacatggtagcaataaaacgcgacagt
gacaatccttattcaagttcaacagagcttgttgagctcagcaaggttgcaaatgctgaa
aagcttgtcccgcttgcatggatatcacatgacggcaactatgtaaaagaagatgctcta
aattatatccagccgctaattgaaggtgaagttgaagtcaagtacgaaagaggtcttcct
cgatatgcaaagctcagaaagataatggtgccaaagaaggtcgtataa

DBGET integrated database retrieval system