KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0862Help
Entry
Calkr_0862        CDS       T01356                                 

Definition
1-deoxy-d-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cki00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
930099..931265
Genome map
AA seq 388 aa AA seqDB search
MTKKICILGSTGSIGVQTIDVAKKLGIKVVGLSAHKNVDLLIKQARELSPDILCIVDEKY
YPLLKENFPDKIVVTGQQGLINIATYPHADLIVNALVGISGLVPTVEAILAGKRVALANK
ETLVTGGKIIKRIISQKQEKDSLPILIPVDSEHSAIFQCLVGEDKKNVKKIILTASGGPF
RGKKFEELQSVKLEDVLMHPTWNMGKKITVDSATLINKGFEVIEAMFFFDKGCDDIEVLI
HPQSIVHSMVEFVDGSVKAQLSYPDMRLPIEYALTFPERGKAVAAPLDLAKVKNLTFEEP
DFDTFFLLKIAYDCAKEGESYPIVLNAANEEAVKYFLEGKIGFVDIMKYVAKIIEGHRLQ
KIETVEDILVIDAEARRRFKNLVEGEKS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagatttgcatcttagggtcaaccgggtccataggtgttcagacaatagat
gttgccaaaaagcttgggattaaagttgttgggctttcagcgcacaaaaatgtggatctt
ttgattaagcaagcaagagagcttagcccggatattttatgtatagtagatgaaaaatat
tatcctctattaaaagaaaattttcctgataagatagttgtaacagggcagcaaggtctg
attaatattgcgacatatccacatgcagatttaatagtaaatgcccttgttggtatatct
ggtttggtgccaacagttgaggctattttggcagggaaaagggttgctcttgccaacaaa
gagacccttgtgacaggtggaaagattataaaaaggattatttcccagaaacaagaaaaa
gattctcttccaattcttattcctgttgactcagaacacagtgctattttccagtgcctt
gtaggtgaagacaaaaaaaatgtaaagaagataattctcactgcatcgggtggacctttt
agaggaaaaaaattcgaagaactgcagagtgttaaattggaagatgtgctgatgcatcct
acatggaacatgggcaagaaaatcacagttgactcagccacccttataaacaaagggttt
gaagtgatagaagctatgtttttctttgataaaggttgtgatgatatagaagtattgata
catccacagagtattgttcattcgatggttgaatttgttgatgggtctgtaaaagcacag
ctatcttacccggatatgcgtcttccgattgaatatgcacttacttttccagaaagaggc
aaagcagtagctgcgccacttgaccttgcaaaagtaaaaaatcttacatttgaagagcct
gattttgatacattttttttgctcaaaattgcatatgattgtgcaaaagaaggagaaagt
tacccgattgtgctcaatgctgctaatgaagaggctgtaaaatatttcttggaagggaaa
attggctttgttgatattatgaagtatgtagctaaaattattgaaggtcacaggttgcaa
aaaattgagacagttgaagacatcttggtaattgacgcagaggcaagaagaaggtttaaa
aatcttgtggaaggtgagaaaagctaa

DBGET integrated database retrieval system