KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1024Help
Entry
Calkr_1024        CDS       T01356                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cki00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086833..1087432
Genome map
AA seq 199 aa AA seqDB search
MREGLLIVISGPAGTGKGTVVGKLLEKNPNIKLSISKTTRKPRPGEKEGVNYFFVSREQF
EEEIKNERFLEYAEYNNNYYGTPKDFVFEALEKGFDVILEIETQGALKIKKAFSDAVLIF
LLPPSIEELYRRLVKRGTESEDEIKARLEIAKNEIKLVPEYDYCVINDNVDDAAEKIQKI
IEVEKLKSRRFDIQSFLKE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagagagggacttttgattgtaatatcagggcctgcagggactggaaagggtacagtt
gttggaaagcttcttgagaaaaatccaaatattaagctttcaatctccaagaccacgaga
aagccgaggccaggggaaaaagagggtgtgaactatttttttgtatcgcgcgagcaattt
gaagaagagattaaaaatgaaagatttttagaatatgctgagtataacaataactattat
ggtacgcccaaggattttgtctttgaggcattggaaaagggctttgatgtaattttggag
attgaaacacagggagcgctcaagattaaaaaagccttttcggatgcagtactaatattc
ttattgccaccatccatagaagagctttatagaagacttgtaaaaagaggcaccgagtct
gaagatgaaatcaaggcaagacttgagattgccaagaacgagataaaacttgtgccagag
tatgactattgtgttataaatgacaatgtggatgatgctgctgaaaagatacaaaagatt
attgaagttgaaaaactaaagagtagacgatttgatatacaaagttttttgaaggagtga

DBGET integrated database retrieval system