KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1093Help
Entry
Calkr_1093        CDS       T01356                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calkr_1093
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calkr_1093
   00600 Sphingolipid metabolism
    Calkr_1093
Enzymes [BR:cki01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Calkr_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153899..1155215
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDSTIALMDIDSIRLEFMRKALQKLIDQEKYS
TRLEATTDRKEALKGAKYVIVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEISYLCAGINHMAWFLKFEWNGKDAYPLIREKANDPEIYTQDVTKFEILKHFG
YYVTESSFHMSEYVPYFRKSDDWINKIHRTHSWHKEHYNGMYLHCCLDAAKTLLEDLRKM
AEADYIDPKRSNEYCATIIHSIETNSPSVINGNVENKGLITNLPEGCCVEVPCLVDKNGI
QPTYVGNLPPQLAALNRTNINVQELAVIAALTGDREAVYHAIMMDPLTSAVLDLDQIRQM
VDEMFEAEKEWLPEKFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagttttcacaaggaacttggtaaga
gacattttgtcgtatccagagctaagagactctacaatagcgcttatggacattgacagt
ataaggcttgaatttatgagaaaagctctgcaaaaactcattgaccaggagaagtattct
acccggcttgaagccacaactgatagaaaagaggctttaaaaggtgcaaaatatgtgatt
gtcacaatacaagtcggaggtttaaaaccttacgaatatgacatttacattcctctaaaa
tacggtgtaaaacaggcagttggtgatacaataggtccaggtggagtttttagggctctt
agaacaataccggttttgcttgacattgcaaaggacatggaagagctttgtccagatgct
cttcttcttaactatgtaaatccaatggcaatgaattgctgggcgttgaataaagctacg
aacataaaaaatgtagggctttgtcatagtgttcaaggaactgctgaatttttagcaaaa
attattggggcaaaaatggaagaaatttcatacttatgcgcaggtataaaccatatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagggaaaaagca
aatgaccctgaaatctatacacaggatgttacaaaattcgagatactaaaacattttgga
tattatgtaacagagtcaagttttcacatgtctgaatatgttccctattttagaaagagc
gacgattggataaacaaaatacatagaacacattcatggcacaaagaacattacaatggt
atgtatctgcactgctgtttagatgctgcgaaaactttgcttgaagacctgaggaaaatg
gcagaggcagactacatcgaccccaagagaagtaacgaatactgtgcaactatcatccat
tccatagagacaaacagtccgagtgtaataaatggtaatgttgaaaacaaaggtttgata
acaaatttacctgaaggatgctgcgttgaagtgccatgtctggttgacaaaaatggtatt
cagccaacttatgttgggaatctaccaccacagcttgcagctttgaacaggacaaatata
aacgttcaagagcttgccgtaattgctgctttgacaggtgatagggaagcagtttatcat
gcaattatgatggaccctctcacaagtgctgttttggatttagaccagatacgccagatg
gtagatgagatgtttgaagctgaaaaagaatggctgccagaaaagttttataggtaa

DBGET integrated database retrieval system