KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1096Help
Entry
Calkr_1096        CDS       T01356                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cki00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calkr_1096
Enzymes [BR:cki01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Calkr_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1156445..1157038
Genome map
AA seq 197 aa AA seqDB search
MIDSIVGIIQEVFSNYVILNYNNVYIKIFCNGTKFSEFLGKEKKVYVSLKFNENLSELEC
YGFLTREERELFLKLQKVTGVGSKLALQILSSIDFQELIVEIAKGNVARLEKVKGIGKKT
ASRIILELKETLKKEFKVAATTGKEEKTYEKLEEISLALLSLGYDIDEVNQVLSSEDFSE
LSLEDGIKLALKKLSKI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatagattctattgtgggaataattcaagaggtatttagtaactatgttatcctcaat
tataacaatgtatacataaaaatattttgcaatggcacaaaattctctgaatttttaggc
aaagaaaaaaaagtgtatgttagcctaaagtttaacgaaaacttatcagagcttgaatgt
tatggttttttgacaagagaggaaagagagctttttttaaagcttcagaaggtaaccggt
gttggcagcaaattagctcttcagattctttcttcaatagactttcaagagcttattgtt
gagattgcaaaaggaaatgtagcaagacttgagaaggtaaaaggaattgggaaaaaaact
gcaagtaggataattcttgagctgaaagagacactcaaaaaagagttcaaagtggctgcc
actacaggtaaagaagaaaaaacttacgaaaaacttgaagaaatatctttagcactttta
tccttggggtatgacattgatgaagtcaaccaggttctttcatccgaagatttttctgaa
ctttctttggaagatggaataaaacttgctttgaaaaagttatcaaagatttga

DBGET integrated database retrieval system