KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1127Help
Entry
Calkr_1127        CDS       T01356                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cki03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1187152..1187751
Genome map
AA seq 199 aa AA seqDB search
MQQKENSISKLIQQLEKLPGIGQKTAQRLAFHIINMKTEDVKALADAILSAKTSTKLCKV
CCNFTEDEVCSICKDEKRDRSIICVVEEPQDVAALERVKEYKGLYHVLHGAISPLKGKYP
EQLTIDVLMKRLSDPQVKEVIIATNPDVDGEATASYLARLIKPMGIKVTRIARGIPVGGD
IEYADEVTILKAIEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagaaagaaaattctatatcaaaactcattcagcagcttgaaaagcttcctggc
attggtcagaaaactgcccagaggcttgcatttcacatcattaatatgaaaactgaagat
gtcaaagcacttgctgatgctatcttgagcgctaaaaccagcacaaaactgtgcaaagtg
tgctgtaactttacagaagatgaagtatgctctatatgtaaagacgagaagagagataga
agcattatctgtgttgttgaagagccacaggacgttgcagcacttgaaagagtaaaggaa
tataaaggactttatcatgtgcttcacggtgcaatatctccgctcaaaggtaaataccct
gaacagcttacaattgatgttctaatgaagagactttctgacccacaagtcaaagaggtt
ataattgccacaaaccctgacgttgatggtgaagcaacagcctcatacttggcgcggctt
ataaaaccaatgggtatcaaggttacaagaattgccagaggaattccagttggcggtgac
attgagtacgctgatgaggttacaattctcaaagcaatagaaggaagaagagaaatttag

DBGET integrated database retrieval system