KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1237Help
Entry
Calkr_1237        CDS       T01356                                 

Definition
peptidase s11 d-alanyl-d-alanine carboxypeptidase 1
Orthology
K07258  
D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Calkr_1237
Enzymes [BR:cki01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Calkr_1237
Peptidases [BR:cki01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Calkr_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1292525..1293880)
Genome map
AA seq 451 aa AA seqDB search
MSQFLKKAVLYLTSSALFFVILFTYPFYTYSQQESNDKLGLSAKSAILVEAHTGQILFEK
NPNLRCFPASTTKVLTALVAISYEHDLSKIFKVSSKATMIEPGSSSYYLNPGETISFQDL
LYAMLLISANDAANVIAENIAGSIPEFVEKMNEYAKSIGAENSHFVNPNGLHSPQHYTTA
YDLSLIARQAYQNEILKKIFSTVEYRITTASMHKKPDWQIIYNINKLLRKNSQYYYPYAT
GIKTGYTAQAKRCLIASAKKNDIELIAVILSSEDAFSDAIKLFDYGFNNFKREKLFSENQ
IVGKVLIDKTNQKWLDGYLKAPVYVLQNVYSPAESNFTYTVDFLKDLKIPIYKDTVIGNV
YIYSKGHLINSIPVLSYESYEIQPAKKILQNVKKGLIKGTKIVIELLIGAILLVLIFTII
IIIKFKRRRAKLKLRATKTIDFSNLHNRRLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtttctaaaaaaggcagtcttatatctaacttcctcagcacttttttttgta
atactttttacataccccttttatacatactcacagcaagagtccaatgacaaacttggc
ttgagtgcaaaatcagccattttagttgaagcacataccggacagattttatttgaaaaa
aatcctaatttaagatgctttcctgcaagtactaccaaggtactcacagcacttgttgct
atatcatatgaacatgaccttagcaagatatttaaagtttcttcaaaagccacaatgata
gaaccaggaagtagcagttattatttaaatccaggtgagactatatcttttcaggacctt
ctttacgcaatgcttttgatatctgcaaacgatgcagctaatgtgattgctgaaaatata
gcaggcagtatccccgaatttgtagagaaaatgaacgaatacgcgaaaagtattggtgcc
gaaaattctcattttgtaaatccaaacggacttcactctcctcagcattatacaactgct
tatgatttgagccttattgcaagacaggcttatcaaaatgaaatattgaaaaagatattt
tctacagttgaatatagaataacaactgcttcaatgcataaaaaaccagattggcagata
atatataacataaataagcttttgcgaaaaaactctcagtattattacccatacgcaaca
ggaataaaaacaggctatacagcccaggcaaaaagatgtttaattgcctcagctaaaaaa
aatgacatagaacttattgcagttattctttcttctgaagatgctttttcagacgcaatt
aagttatttgactacggttttaataacttcaaaagagagaaacttttttcagaaaatcag
attgttggaaaggtgttaatagataaaacaaaccaaaaatggcttgatggctatctcaaa
gcccctgtctatgttcttcaaaatgtttattctccagcagaatccaattttacttatact
gtagactttttaaaagaccttaaaatccccatatacaaggatacagtaattggaaatgta
tatatatacagcaaggggcatcttataaactctattcctgtgttatcatatgagagttat
gagatacagcctgcaaagaaaattctccagaatgtaaaaaaaggattgataaagggcact
aaaatagtgatagaacttttgataggagctattttacttgtacttatattcacaataata
atcataatcaaatttaagcgcagaagagccaaacttaagctcagagcaacaaaaacgata
gacttttcaaacctgcacaacagaagattaaaataa

DBGET integrated database retrieval system