KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1246Help
Entry
Calkr_1246        CDS       T01356                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calkr_1246
   01230 Biosynthesis of amino acids
    Calkr_1246
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_1246
   00030 Pentose phosphate pathway
    Calkr_1246
   00051 Fructose and mannose metabolism
    Calkr_1246
   00052 Galactose metabolism
    Calkr_1246
  Energy metabolism
   00680 Methane metabolism
    Calkr_1246
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Calkr_1246
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calkr_1246
Protein phosphatases and associated proteins [BR:cki01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calkr_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301204..1302172
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccaggaatgaac
gctgctatacgagctgttgtaagaactggtatatactacgggtttagagtgatgggcata
agacgtggctataatggtcttattgaaggcgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgtggtggaacaatacttttgactgcaaggtctcctgagttcatg
acagaaaatgggctcaaaaaagctgcttcaatgtgcaaaatctttaagattgatgctctt
gttgtaattggtggagatgggtctttcaggggagcaagagacctgagtaagtttggtata
aatgttgttggaattcctggaaccatcgacaatgacatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgtacaggatgcaattaataagataagagacacggca
acctctcatgaaagagttagcatccttgaagtaatgggacgtcatgctggatatattgct
ctttatagcggtattgcaggcggtgctgagtcaattgtgattcccgaaaaaggtcttgac
aaagatgagataatcagaagaataattgatggcaaaaacaaaggaaagctccataacttg
attatattggctgagggaattggtggagcaacagaacttgcaaaggagattgaagaagca
acaggaatagagacaagggcgacaatacttggatatatccagagaggtggatcgcctact
gcgtatgacagagttgttgcaagtttgatgggagcaaaagctgttgaggttatcaaagaa
ggtaagcagaacaggataattgcgatgaaggatggcaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaacttagctactattctt
tctttataa

DBGET integrated database retrieval system