KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1300Help
Entry
Calkr_1300        CDS       T01356                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Calkr_1300
Enzymes [BR:cki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Calkr_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355267..1356124
Genome map
AA seq 285 aa AA seqDB search
MGFNLYKPFFLCATENYQASTIVLAGIPMDLTVSFKPGSRFAPAKIREVSIELEEYSIYQ
DKSLYDKTFCDMGDLELPFGNVERSIEAIYLFACKLFEEKKVPIFLGGEHLISFPLIKAA
ANSTDEELYVLHFDAHADMREEYLGEKFSHATVMRRVGELIGFKNIYQFGIRSGSKEEIE
FAKKNSNLYLVDKWCKIDDVIKNLKGKKVYLSIDIDVFDPAFAPGTGTPEPGGILSSDFF
DILLKLKDLDIIGADIVEVAPYYDISDRTALLAAKIVRELILMIE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaatctctacaaacctttttttctatgtgcaacagaaaattatcaagcaagt
accatagttttagccggaattcctatggatttaacagtaagctttaaacctggctcgcgt
tttgcacctgcaaagataagagaagtgtcaatagagctggaggagtattctatctatcaa
gacaaaagcctttatgataagaccttttgtgatatgggagatttagagcttccttttgga
aatgtagaaagaagtattgaggcaatatatctatttgcttgtaagctgtttgaggagaaa
aaagtccctattttcttgggcggtgaacatctgattagttttcctctaataaaggcggca
gcaaattcaactgatgaagagttgtatgtacttcattttgatgctcatgctgatatgaga
gaagagtatcttggtgaaaagttttcacatgccactgtcatgagaagagttggtgagcta
ataggctttaaaaatatataccaatttggtataaggtctggatctaaagaagaaattgaa
tttgcaaaaaagaatagcaatctttatttggttgacaaatggtgtaaaattgatgatgta
ataaaaaatttaaaaggcaaaaaggtatacctatcgatagatatagatgtttttgacccg
gcttttgcacctggtacaggaacacctgagccaggcggaattctatcttcggattttttt
gacattttacttaaattaaaggacctcgatataataggagcagacatagtggaagttgct
ccatactacgatatttctgacagaacagcactacttgccgcaaagatagtaagagagctg
atattgatgatagagtaa

DBGET integrated database retrieval system