KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1568Help
Entry
Calkr_1568        CDS       T01356                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00900  Terpenoid backbone biosynthesis
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Calkr_1568
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Calkr_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C YcaO
Motif
Other DBs
NCBI-ProteinID: ADQ41061
UniProt: E4S9R8
Position
complement(1625721..1626581)
Genome map
AA seq 286 aa AA seqDB search
MELKAYAKINLALDVLSKREDGYHEIRTIMQTVDLYDIINIEKIEEDSIIVTTSSENIPT
DNKNHAYIAASLLKERFEVKQGVRIHIEKNIPVSAGLAGGSTDAAAVLKGLNEIFELNLS
EQQLMEIGREIGADVPFCLVGGTALCEGIGEKVIKLKAAPQMNILIAKPEVYVSTQAVYE
ALDLSKIKKRPNIEAMISAIEEGNVKEIAKNLCNVLEVVTVNQYPVINRVKDIMRNNNAL
GTVMTGSGPAVFGIFGNKYDALKAAERLKVFIKEIILTTTCEGSGV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttggaactcaaggcttatgctaaaattaacttagcattagatgtgctttcgaaaagagaa
gatggctatcatgaaataagaactataatgcaaacagtggatttgtatgatataatcaat
attgaaaagatagaagaagacagtataattgtaacaacttcaagtgaaaatattccaact
gacaataaaaaccatgcatacattgcggcttcacttttaaaagagcgttttgaagtaaag
caaggtgtgagaatacatattgaaaagaacattccggtctctgcaggtttagctggtgga
agcactgacgcagcagcagttttaaaaggtctgaatgaaatatttgagctaaatctttct
gagcagcagcttatggaaattggaagagagattggtgctgatgttccattttgtttggta
ggcggcacagccctctgtgagggaattggcgaaaaggtgataaagcttaaggcagctcct
cagatgaatatcctcattgcaaaaccagaggtatatgtttctacgcaggctgtgtatgag
gcattggatcttagcaagataaaaaagagaccaaacattgaagctatgatttcggcaatt
gaagaaggtaatgtaaaagagatagcaaagaatctttgcaatgttttagaggtggttaca
gtaaatcagtatccagtcataaacagagtcaaggatattatgagaaataacaatgctctt
gggacagttatgacaggaagcgggccagctgtatttgggatttttggcaacaagtatgat
gctttaaaagctgcagagaggctcaaggtgtttataaaagaaattatcttgactacaaca
tgtgaaggcagtggagtttag

DBGET integrated database retrieval system